KEGG   Esox lucius (northern pike): 105014407Help
Entry
105014407         CDS       T04894                                 

Gene name
gck
Definition
(RefSeq) glucokinase
  KO
K12407  glucokinase [EC:2.7.1.2]
Organism
els  Esox lucius (northern pike)
Pathway
els00010  Glycolysis / Gluconeogenesis
els00052  Galactose metabolism
els00500  Starch and sucrose metabolism
els00520  Amino sugar and nucleotide sugar metabolism
els00524  Neomycin, kanamycin and gentamicin biosynthesis
els01100  Metabolic pathways
els01200  Carbon metabolism
els04910  Insulin signaling pathway
Module
els_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
els_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:els00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    105014407 (gck)
   00052 Galactose metabolism
    105014407 (gck)
   00500 Starch and sucrose metabolism
    105014407 (gck)
   00520 Amino sugar and nucleotide sugar metabolism
    105014407 (gck)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    105014407 (gck)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    105014407 (gck)
Enzymes [BR:els01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     105014407 (gck)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 Poty_PP
Motif
Other DBs
NCBI-GeneID: 105014407
NCBI-ProteinID: XP_010875012
LinkDB All DBs
AA seq 477 aa AA seqDB search
MPCVSSYMGQMKMSHGLSHVLETAIMVEQILSEFRLKKEQLKEVMKRMMSEMDRGLRVET
HQEASVKMLPTYVCSTPEGSEVGDFLALDLGGTNFRVMLVKVGEDEERGWKVETKHQMYS
IPEDAMTGTAEMLFDYIAECISDFLNIQHIKHKKLPLGFTFSFPVRHEDIDKGILLNWTK
GFKASGAEGNNVVGLLRDAIKRRGDFEMDVVAMVNDTVATMISCYYEDRSCEVGMIVGTG
CNACYMEEMRTVELVEGEEGRMCVNTEWGAFGANGELEEFRLEYDRVVDETSLNPGQQLY
EKLISGKYMGELVRLVLVKLVNEELLFKGEASDLLKTRGAFETRYVSQIESDSGDRKQIY
NILSTLGVLPSELDCDIVRLACESVSTRAAHMCGAGLAGVINRMRERRSQEALKITVGVD
GSVYKLHPCFQHRFHNVVRELTPHCDITFIQSEEGSGRGAALISAVACKMAACMLTQ
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgccgtgtgtcagctcctacatgggccagatgaagatgtctcatggtcttagtcatgtg
ctagagacagccatcatggtggagcagatcctgtcggagttcaggctgaagaaggagcag
ttgaaagaggtgatgaagaggatgatgagcgagatggaccggggactgcgggtcgagaca
caccaggaggccagcgtcaaaatgttgcccacatatgtctgctccacccctgagggatca
gaggtgggtgatttcctggccctggacctaggtgggactaacttccgtgtgatgttggtg
aaggtgggggaagatgaggagagagggtggaaggtggagaccaaacaccaaatgtactcc
atccccgaggacgccatgaccggtacggccgaaatgctctttgattacattgcggagtgc
atttcggacttcctgaacatacaacacatcaaacacaagaagcttcctctgggcttcacg
ttctccttcccagttcgacacgaggacatagacaagggcatcctactgaactggacaaaa
gggttcaaggcatctggagctgagggcaacaatgttgtggggctgctgagagatgccatc
aagaggagaggggattttgagatggatgttgttgccatggtgaacgatacagtcgccacc
atgatatcttgctactacgaggaccgcagttgcgaagttggaatgattgttggtactggg
tgtaacgcgtgctacatggaggagatgcggacagtggagctggtggaaggggaggagggg
aggatgtgtgtgaacactgagtggggggcgttcggagctaacggggagctggaggagttc
agactggagtacgacagagtggtggatgaaacttcactcaaccctgggcagcaactctat
gagaagttgatcagcgggaaatacatgggcgagctggtgaggctggtgctggtcaagctg
gtgaacgaagagctgttgtttaaaggcgaggcctctgacctgctgaagactcgcggtgcc
tttgagacacgctacgtgtcccagatagaaagtgactctggagacagaaagcagatctac
aacatcctgtccacgctgggcgtgttgccctcagagctggattgtgacatagtgcgcttg
gcatgtgagagcgtgtccacgcgggcagcacacatgtgcggggcaggtctagccggcgtc
atcaaccgcatgagagaacgtcgcagccaggaggcgctgaagatcactgtgggtgttgat
ggctctgtctacaaactccacccttgtttccagcataggttccacaacgttgtacgggag
ctcacgcctcactgtgacatcactttcatccagtcagaggaagggagtggccgaggggcg
gcgcttatctctgcagtagcctgtaagatggcagcgtgcatgctgactcagtga

DBGET integrated database retrieval system