KEGG   Esox lucius (northern pike): 105014442
Entry
105014442         CDS       T04894                                 

Gene name
trpv4
Definition
(RefSeq) transient receptor potential cation channel subfamily V member 4
  KO
K04973  transient receptor potential cation channel subfamily V member 4
Organism
els  Esox lucius (northern pike)
Pathway
els04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:els00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    105014442 (trpv4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:els04040]
    105014442 (trpv4)
Ion channels [BR:els04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   105014442 (trpv4)
SSDB
Motif
Pfam: Ank_2 Ion_trans Ank_3 Ank Ank_4 Ank_5
Other DBs
NCBI-GeneID: 105014442
NCBI-ProteinID: XP_010875065
LinkDB
AA seq 900 aa
MTFDLDGVVTWMIFFQGRSTSTQLRRYLVARTDTPSSAAPKAAPFSGSGEVDADEEGQPD
ANGTYNELSALADLFESDEGSLSPPDPAKDPAQDNIRPGQLPPGDGRQNLRMKFHGAFKK
GISNPMDRLESTIYELPVAPGPKKAPMDSLFDYGSYRDTSHKKPRRKKLPRGKTEVSCEE
DVVDPPGSDPPKVVKVFNRTLLFDGVSRADPEALSGLLDYLQGHNKRLTDEEFKEPSTGK
TCLPKALLNLYGGKNDTISLLTDIAEQTSNLHEFINTPFRDVYYRGQTALHIAIERRCKH
YVKLLVEKGADVHAQARGRFFQPREEGGYFYFGELPLSLAACTNQPDMVHYLTENPHKKA
DLRRQDSRGNTVLHALVHIADNTKDNTRFVTKMYDLLLTKCVKLYPECNLEEVLNNDGMS
PLMMAAKLGKIGVFQHIIRREIKDEEARHLSRKFKDWAYGPVYSSLYDLSSLDTCGEEAS
VLEILVYNSRIENRHEMLAVEPINELLRAKWQKFAAVTFYISVVSYIVTMVIFTLVAYYR
PSQGTPPYLYSTSTDYLRLAGEVVTLCSGVFFFITNIKDLFLKKCPGVKSLFVDGSFQLL
YFIYSVLVLVTAGLYLSGVEAYVSVMVFALVLGWMNTLYFTRGLKLTGTYSIMIQKILFK
DLFRFLLVYVLFMIGYASALVSLLTVCPGPEEVCPASGCLNYPHCRDTNTFSKFLLDLFK
LTIGMGDLDMASSAQYPVVFLILLVTYIILTFVLLLNMLIALMGETVGQVSKESKKIWKL
QWATTILDIERSFPVCLRKSFRAGEMVTLGKNWDGTPDRRWCFRVDEVNWCHWNQNLAII
NEDPGKNVTEALQSSGSMRQTVRGMRRDRWSTVVPRVVEQNKGTQLRDHVLEMESLTSRH
NT seq 2703 nt   +upstreamnt  +downstreamnt
atgacctttgaccttgatggagtagtaacctggatgattttctttcagggtcgctccaca
tccactcaactgagaaggtatcttgttgcgaggacggacaccccttcctcggctgctccc
aaagctgccccattctccggctcaggggaggtagatgcagatgaagagggacagcctgat
gccaatggaacctacaatgaactgtcggcactggccgacctgtttgaaagtgatgagggc
tccctgtcgccaccggacccggccaaagacccagcacaggataatatccggccaggccag
ctacctccaggggacggtcggcagaacctccgtatgaagttccatggtgcctttaaaaag
ggcatctccaaccccatggacaggctggagtcgacaatctacgagttacccgtggcccct
ggccccaagaaggcccccatggactcactgtttgactatggcagctacagggataccagc
cacaaaaagccacgtcggaagaagctcccacgaggtaagactgaggtttcctgtgaggaa
gatgttgtggacccaccgggctcagacccacccaaagtggtgaaagtcttcaaccgcaca
ctgctctttgatggcgtgtccagggctgacccagaggccctctccggcctgctggattac
ctgcaaggtcacaacaagagactcacggacgaggagttcaaagaaccttctaccggtaag
acgtgcctgcccaaagccctcctgaacctttatggtggtaagaatgacaccatctctctg
ctgacggatatcgcggagcagacatcgaacctccatgaattcatcaacacgcccttcaga
gacgtttattaccgaggccagacagcgctccacattgccattgagaggcgctgtaagcac
tatgttaagctgctggtggagaagggggctgacgtccacgcccaggcccgaggacgcttc
ttccaacccagggaagaggggggctacttctacttcggcgagctgcctctgtcgctggca
gcgtgcaccaaccagccggacatggtgcactacctgacggagaacccccataagaaggcc
gacttgcggcggcaggactcccggggaaacacggtgctgcatgccctggtgcacatcgcc
gacaacactaaggacaacacccgattcgtcaccaagatgtatgacctgctgctgaccaag
tgtgtcaagctgtaccccgagtgcaatctggaggaggtgctgaacaacgacggcatgtcg
cccctcatgatggcggccaagctggggaaaattggggttttccagcacatcattcgcagg
gagatcaaggacgaggaggcgcgtcacctctcacgcaagttcaaagactgggcgtatggc
cctgtgtactcctccctgtacgacctctcttccttggacacctgtggagaggaagcgtct
gttctggagatcctggtctacaacagccgcattgagaatcgccacgagatgctggctgtg
gagcccatcaacgagctattgagagccaagtggcagaagtttgctgctgtcaccttctac
atcagtgtggtttcctacatagtgaccatggtcatcttcaccctggtggcttactacagg
ccatcccagggaacgcctccatacctctactccacctccacagactacctgcgtctggca
ggggaggtcgtcaccctgtgctctggggtcttcttcttcatcaccaacattaaggacctc
ttcctgaagaaatgccctggggtgaaatccctgtttgtcgacggctcctttcaactgctc
tacttcatctactctgtgctggtgttagtgactgcgggcctctatctgtcgggtgtggag
gcgtacgtgtctgtgatggtgtttgcgttggttctgggatggatgaacactctgtacttc
accagaggcctgaagctcactggtacctacagcatcatgatacagaagattctcttcaaa
gatcttttccggtttctgctggtctatgtgctcttcatgattggatatgcatcagctctc
gtgtccctcctgacggtatgccccgggccggaggaggtgtgtcccgcgagcggttgcctc
aactacccccattgccgggacacaaacaccttcagcaaattcctgctggacctgttcaaa
ctgaccattggaatgggtgatctggacatggccagcagtgcccaatacccagtggtcttc
ctcatcctgctggtcacctacataatcctcaccttcgtgctgctgctcaacatgttgatc
gctctgatgggggagacggtgggccaggtgtccaaagagagcaagaagatctggaagctg
cagtgggctacaaccatcctggacattgagcgttcattccctgtgtgtctgcggaagtcc
ttccgtgccggagagatggtaaccttggggaagaactgggacggcaccccggaccgccgc
tggtgcttcagggtggacgaggtcaactggtgccactggaaccagaacctagccataatc
aacgaagacccgggcaaaaacgtgacagaggctctccaaagctccggcagcatgcgtcaa
actgtccgcggcatgcggagagatcgttggtccactgtggttccccgggtcgtggagcag
aataaagggactcagctacgggaccatgtactggagatggagtcactgacctccaggcac
tga

DBGET integrated database retrieval system