KEGG   Esox lucius (northern pike): 105014909Help
Entry
105014909         CDS       T04894                                 

Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 9 isoform X1
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
els  Esox lucius (northern pike)
Pathway
els00512  Mucin type O-glycan biosynthesis
els01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:els00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    105014909
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:els01003]
    105014909
Enzymes [BR:els01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     105014909
Glycosyltransferases [BR:els01003]
 O-Glycan biosynthesis
  Mucin-type
   105014909
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 Glyco_transf_7C Chordopox_A13L
Motif
Other DBs
NCBI-GeneID: 105014909
NCBI-ProteinID: XP_010875917
LinkDB All DBs
AA seq 607 aa AA seqDB search
MAVARRIKTLLTMNICAFVAIILFSVYSRIQDRLEELVKYGRTTEQRSSRRNEKVTNFVD
KQAILQRLEHLEDVVYHQLNGLGKAPEVLEGPVSQGQGPFRTKSTVKNPVRDPDGGEYEE
YGYNAQLSNQIPLDRSIPDYRPIKCQLMIYPDDLPQLTVVFIFVNEALSVILRSVHSLVN
HTPAHILKEIILVDDNSDSVELKLNLDQYVNKRYPGLVKIVRNSRREGLIRARILGLKAA
TAPVVGFFDAHVEFNKAWAEPILTRIKEEPTRIVLPSIDNIKYNTFEVQRYDNAAHGYNW
GLWCMYINPPQAWLDRSDDTAPIRTPAMIGCSFVVNRKHFEDIGLLDPGMEVYGGENIEL
GMRVWQCGGSMEVLPCSRVAHIERTKKPYNNDIDYYAKRNALRAAEVWMDDYKSHVYMAW
NIPINNPGVDFGDVSERIALRKKLKCRSFQWYLQNVYPEMRVYNDTITYGEVRNSKASGY
CLDQGPEEDNSAILYPCHGMTSQLAHYTSEGLLQLGPLGSTTFLPDTKCLVDEGQGRTPG
LKECQEVSRSSQRLWDFTQNGPIISRDTGRCLEVEIFKEVVFGLRLVVQRCSGQRWTIRN
WIRPPRH
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atggctgtggcacggcggataaaaactttgctgactatgaacatttgcgcatttgttgct
attatcctgttctcggtttacagcagaatccaggatcgtttagaggaactcgtgaagtat
ggcaggacaaccgagcaaagatcaagccgtagaaatgaaaaggttactaactttgtggac
aagcaagctattcttcaaagacttgagcatctcgaggacgtggtttatcatcaactgaac
ggtctgggaaaggctcctgaggtactagaaggaccagtcagccaaggacaggggccgttc
aggacaaaatccactgtgaagaaccctgtgcgtgacccagatgggggagagtatgaggag
tatggatacaatgcccagctgagcaatcaaatcccactggatcgatccattcctgactac
aggccaataaagtgccagctgatgatttatccagatgacctccctcagttgactgtggtg
ttcatctttgtgaacgaggccttgtctgtgattctacgctcagtccacagcctggtcaat
cacacacctgcacacatcctaaaggagattatcctagtggatgacaacagtgacagtgtg
gagctaaagctgaacctggatcaatatgtgaataagcggtatccaggcctggtaaagata
gtgagaaatagtagaagggagggacttatccgggccagaatcctcgggttaaaagctgct
actgcaccagtcgttggattcttcgatgcacatgtcgagttcaacaaagcatgggcagag
ccaatcctgaccagaatcaaggaggagccaacccgtattgttctcccgtctattgacaac
atcaagtacaacacgtttgaggtgcagcgctatgacaacgccgctcacggctacaactgg
ggcctgtggtgcatgtacatcaacccccctcaggcctggctggaccgaagtgatgacacg
gcgcccattaggaccccggccatgattggctgttcctttgtggtgaacagaaaacacttt
gaagatattgggcttctggacccaggcatggaggtgtatgggggagagaacattgaattg
ggcatgagggtgtggcagtgcgggggtagtatggaggttttgccgtgttcccgggtagca
cacattgaacgcaccaagaaaccgtacaacaacgacattgattactacgccaagcgcaat
gccttgagggcagctgaggtgtggatggatgactacaaatcccacgtctacatggcctgg
aacatccccattaataaccccggggtcgattttggcgatgtttcagaacgaattgccttg
aggaagaaattgaaatgtcgcagtttccagtggtacttgcagaatgtttatccggagatg
cgggtgtacaatgacaccatcacctacggcgaggtgcggaacagcaaggccagtggctat
tgcttagaccaagggcctgaggaggacaacagtgcgattctctatccatgtcatggcatg
acgtctcagctggcccattacacctcagagggactcctgcagcttggccctctgggctct
actacttttctgccggacaccaagtgtctggtggacgagggccaaggacggacccctggt
ctcaaagaatgtcaggaagtgtcgcgctcatcacaaaggctttgggacttcactcagaat
ggtccaataatcagccgagacacaggccgctgtttggaggtggagatctttaaggaggtc
gtcttcggcctgcgactggtggttcagaggtgctctggtcagaggtggaccatcaggaac
tggatcagacctccacgacactga

DBGET integrated database retrieval system