KEGG   Esox lucius (northern pike): 105014918Help
Entry
105014918         CDS       T04894                                 

Definition
(RefSeq) histone-lysine N-methyltransferase SETD1B-A isoform X1
  KO
K11422  histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
els  Esox lucius (northern pike)
Pathway
els00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:els00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    105014918
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:els03036]
    105014918
Enzymes [BR:els01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     105014918
Chromosome and associated proteins [BR:els03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     105014918
   HMT complexes
    COMPASS/SET1 complex
     105014918
    COMPASS/SET1 complex (yeast)
     105014918
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: N-SET SET RRM_1
Motif
Other DBs
NCBI-GeneID: 105014918
NCBI-ProteinID: XP_012992582
LinkDB All DBs
AA seq 1854 aa AA seqDB search
MSKPGERNRLNEDHGRKQSSSLPNGMENHHPVCSSGEKRSHHWRSYKLIIDPALKRGSHK
LYRYDGTTFNIPNPGMPPVDIVRDPRIGRLWTKYKETDLPVPKFKIDECYIGRVPPKEVT
FAKLNDNIREGFLTDMCKKFGDIEEVEILYNPKNKKHLGIAKVVFGTVKSAKDAVQTLHN
TSVMGNFIHVELDPKGENRLRYFQLLLNGTFTPRTLPVGGEDTRELSPHSLAKALMACEP
LRRLSESSSSVAVGGTVTPSSTGTNTTPLSQETAYSSLRQDTPQSQGTPRQSGTPFSQDS
NYSSRQSTPAYQSSRAEGSGGFKSRRHESKFQDAYNRRPERRYVHGSGGSGSYRGNSEPT
AFKPHQPAPPEPPPAAASFAHTPPPPASAGFTSAFSPYQQPPVPPAFPPSEPPFQQPPXR
RPPQPPPAPATDVIPVKDKPGTPPVPEPPPEPKAPPSTPPGRTPDHCPPSPGTPTLESER
NSLDSRIEMLLKEKRTKLPFLPGGDSSDTEVRMDGSPISSSSSQLSPIPPFGGAHTSRPP
STGLEDVSPTPLPDSDDEEPVPGTGLLIKRLGSPVPIPGKNASDLKDGHLGNHTPTEKVE
SHQSSGEDMEISDEEDVPGTPTHSGDCAKGIVVNSAVSPMQPIPLPPPGFPPLPPQAGFG
LPHHLSAVPGPHPHLTPGGPHPMLPHLYPPGMVPMMQMELMSCLPQWGSVHMSFQMQTQM
LSRMAQTRGPYPYPHFMTAGGAAAAGSAAMQFGGPYPPLSMSSTPAASAGGHAQQPWPHP
SLPKFNPAVPPPGYEVKKEDPHKATVEGVLLVIVKELKAIMKRDLNRKMVEVVAFRAFDE
WWDKKEHSAKASLTPVKTGEGKEEEKEKPKPKETLGSSLLENWNKGEGLGYEGMGLGIGL
RGAIRLPSFKVKRKDPPEATSTGDTKRARPSTPVDDELEDIAELPEDDSRVDEDSAASRR
RHSRPLELDSEGEEEVETSEKEESLSDREEEPDETEASERLSSSKDSGDEEDDEEEDEAA
SSSDGESSESSDEDVASSASSKADSDSSASGDSSDYESSSEEEEEEEEEEAVDVESLADK
DENRVQTSSSSSSSSSSSSEDEAEPKAPSTPLGPPPDDEPSELSGVEDHSPREGLKPNHR
ALMEEEAVEPGLSSLEDLRPPSPKGVPADEPDIYLEVVVPILKTEPDDVTNLRPPTPTGS
LADSDPDAQPKAHLEDLPCTPGRGAPASLEPDTALLRSLAVPLTHLPLPPTSGAGCHALL
LPPPGPLPDLHFRARLSTDEDLPRTPGRDLMDRTRSLGKSQSSTDTVPITPGGEAPLTGS
SLASLSSPHISGSPFSYPAQSPNLSAGIPRTPGRDLTFTPVFPDPNAMAPGLPLHRKESP
LFKEPPLGIPASQTPAFGALQGEALTSVPKDLPAVPAVDLPVPPDVTPPKRKPGRPKSKK
ALAALASPKTESMELLVTPVIMPPSLPQDAHLTELSANMAAAATFPDIPSRSGLDSSVLG
LDLREGEMEPNTVLPPDDRCLRYDDEESIQKPPRKARRGWEELLLASHSPVTTPPRLHYH
PRSEFEEMTILYDIWNDGIDEEDIRHLQVTYDKMLQQDNGNDWLNDTLWVQHPPTNIPAV
KRKKRDDGMRDHMTGCARSEGYYKIDKKDKIKYLNSNRHLLEEGPVDMQGMSIPAQPLVS
TRAGSERRSEQRRLLSSFSCDSDLLKFNQLKFRKKKIRFCKSHIHDWGLFAMEPIAADEM
VIEYVGQNIRQVIADMREKRYEDEGIGSSYMFRVDHDTIIDATKCGNFARFINHSCNPNC
YAKVITVEAQKKIVIYSRQPINVNEEITYDYKFPIEDEKIPCLCGAENCRGTLN
NT seq 5565 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagccaggggaaagaaacaggctaaacgaagaccatggcagaaagcagagttca
agtttgccgaacggcatggagaaccaccatcccgtttgcagttcgggggagaaacgaagt
caccattggagaagttacaagttgattattgacccagcgctgaaaaggggatcgcacaaa
ctgtatcgctacgatggaacgacatttaacatacccaaccctgggatgccaccagtggat
atcgtccgagacccgagaatcggtcgtctctggacgaagtataaggagaccgatctccca
gttccgaagtttaagattgatgaatgttacatcggccgtgtgcctcccaaggaggtgaca
tttgctaagctgaacgataatatcagagaaggttttttgactgacatgtgcaaaaaattt
ggggacatagaagaggtggaaattctgtacaatccgaagaacaaaaagcatttgggaata
gccaaagtggtttttggaactgtaaaatcggccaaggatgctgtccagactctacacaac
acatctgtcatgggcaacttcatccacgttgagctggatccgaaaggtgagaatcggctt
aggtacttccagctactgttgaatgggacattcaccccccggacccttccagtgggagga
gaggataccagggaattgtcccctcatagcctggctaaggctcttatggcctgtgaaccc
ctgcggcggctctccgagagcagctcatccgtagcggtgggagggacggtgaccccgagc
agcactggcaccaacaccacccccctgtcccaggaaacggcctactccagcctgcgacag
gacacaccgcagtcccagggcacgcctcggcagagcggcacaccgttctctcaggactcc
aactactccagccggcagtccacgccagcctaccagtccagccgggccgaaggctccggg
ggtttcaagtctcggagacatgagagcaagttccaggacgcatacaaccggaggccggag
agacgctacgtccatggcagtggggggtcagggtcctaccgaggcaactctgaaccgacc
gccttcaagccacaccagcccgctcctcccgaaccccctccggccgccgcatcctttgct
cacacccctcctccacccgccagtgctggcttcacatctgcgttttccccttatcagcag
ccccctgtgccccctgctttccccccctccgagcctccgttccagcagcctccccmgcgg
cggcccccccagccccccccggcccctgccaccgatgtcataccggtcaaggacaagcca
ggcactccccccgttccagaaccgccgcctgaacccaaggccccccccagcacgccccct
ggccgtaccccggatcactgccccccctcccctgggacacccaccctggagtcagagcga
aatagcctggattcccgtattgagatgctcctgaaggagaaaaggacaaagcttcctttc
ctccccggaggcgactcatcggacaccgaggtgcgtatggacgggagccccatctcgtcc
tcttcgtcccagctgtcgcccattcctcctttcgggggcgcccacacctctcggcccccc
agcacgggcttggaggatgtcagccccactcccctgcctgactcggacgacgaggagccc
gtccctggaacaggcctgctcatcaagaggctcggctctccagtcccgatccccgggaag
aacgccagtgacctgaaggatggtcacctcggaaaccatacgccaacagaaaaggtggag
agccatcagtcctctggggaggacatggagatctcggacgaggaagacgtacccggcaca
ccgacgcacagcggcgactgtgccaagggcatcgtggtcaactcggccgtgtcgcccatg
cagcccatccccctcccgccccccggcttcccccctctacctcctcaggccggcttcggc
ctcccccaccatctctccgccgtcccaggcccgcaccctcacctgacgccaggagggcct
caccccatgctgccccacctctacccacctggcatggtgcccatgatgcagatggagctg
atgagttgcctgcctcaatggggcagcgttcacatgtccttccagatgcagacccagatg
ctgagtcgaatggcccagacccgcgggccctacccctacccgcacttcatgaccgcggga
ggggcggccgcagccgggtcggctgccatgcagttcgggggtccctacccgcccttgtcg
atgagcagcaccccggctgccagcgcgggaggccacgcccagcagccctggccccacccc
tccctgcctaagttcaaccctgctgtccccccgccgggctacgaggtgaagaaggaggac
cctcacaaggccaccgtggaaggggtgctgttggtcatcgttaaggagctgaaggccatc
atgaagagggacctgaaccgcaagatggtggaggtggtggccttccgggcctttgacgag
tggtgggacaagaaggaacactccgccaaggcgtccctgaccccagtgaagaccggtgag
gggaaggaggaggagaaggagaagcccaaacccaaagagaccttgggctccagtctcctg
gaaaactggaacaagggagaaggcctcggctatgagggcatgggcctgggcatcggccta
cgaggagccatccgccttccctccttcaaggtgaagaggaaggaccctcctgaagccacc
tccaccggagacactaagcgagcccggccctcgacccccgtggacgatgagctggaggac
atagcggagcttcccgaggatgactccagggtggacgaggacagcgcggcatcgcggagg
cgacactcccggccgctggagctggacagtgagggagaggaggaagtggagacctccgag
aaggaggagtccctgtccgacagggaggaggagcctgatgagacagaagcctctgagagg
ttgtcgtctagcaaggacagtggagacgaagaggatgatgaggaagaagacgaggcagct
tcatccagtgatggtgaatcatcagagtcgtctgatgaggacgttgccagttcagcatct
tctaaagcagactctgactcctctgcgagcggggactcctccgattatgaatcctcttcg
gaggaagaagaggaggaggaggaagaggaggcagtcgatgtggagagcctagctgataaa
gatgagaaccgggttcagacctcttcgtcctcctcgtcctcctcatcctcctcgtctgag
gacgaggcagagcccaaggcccccagcacgcccctaggccctcccccagacgatgagccc
tcagagctgtctggtgtggaggaccacagtcccagggaggggctgaagcccaaccacaga
gccctcatggaggaggaggcagtggagcctggcctgtccagcctggaggacctccggccc
ccttcccccaaaggagtcccagccgacgaaccggatatttacctggaagtcgtcgtcccc
atattgaaaacggagccggatgatgtcaccaacctgcggccgcccactccgacaggctcc
ctggctgacagcgacccggatgcccaacccaaggcccacctggaagacctgccatgtacg
ccaggtagaggggctcccgcgtccctggagcccgacacagccctacttcgatccctagcc
gtccctctgacgcacctacctcttccccctacttccggcgcggggtgccacgccctactt
ctcccgccccccggccctctgccggatctccacttcagggccaggttatccacggacgag
gatttgccccggaccccgggtagagaccttatggacaggaccaggagcctgggcaagtcc
cagagcagcacagacacagtgcccatcacgccaggcggcgaagctcccctgaccggaagc
agcctggctagcctcagctccccccacatctccggcagccccttctcttaccccgcccag
tcccccaacctgagtgcaggcatcccccgaaccccgggcagagatctgaccttcacccct
gtcttcccagaccccaacgccatggcccccgggctgcccctgcaccggaaagaaagcccg
ctgttcaaagagcctcctctcggcatcccggccagccagaccccggcctttggcgccctc
cagggagaggccttgaccagcgtgccgaaagacctgccagctgtccccgccgtggacctc
cctgtgccccctgatgtgacaccccccaagagaaagcccggtcgacctaagagtaaaaag
gctttggcggcactcgcttcaccgaaaacggagtccatggagctcttggtgacccccgtc
atcatgccgccctcactgccccaggacgctcatctcacggagctttccgccaacatggct
gctgcggccaccttccccgacatccccagccgctccggcctggactcctccgtgctgggc
ctggatctccgggaaggagaaatggagcccaatacagttctcccgcccgacgaccgctgc
ctccgctacgacgatgaggagtccattcagaagccaccgcggaaggcgcggcgaggttgg
gaggagctgctgctggccagccactcgcctgtaaccacgccaccgcggctccactaccac
ccacgctcggagtttgaggagatgaccatcctgtacgacatatggaacgacgggatcgat
gaggaggacattcggcatctgcaggtcacctacgacaagatgctgcagcaagacaacgga
aacgactggctgaacgacactctgtgggtccaacaccctcctaccaacatcccggcggtg
aagaggaagaagagggacgatggcatgagggatcacatgactggctgtgcccgtagcgag
ggctactacaagatcgacaagaaggacaagatcaaatacctaaacagcaaccggcacctg
ctggaggaggggcctgttgacatgcagggcatgagtattcccgctcagcctctggtctcc
accagagctggctctgagcgccgctctgagcagcgccgcctgctgtcctctttcagctgt
gacagtgacctgctcaagttcaaccaactgaagttccgtaagaagaagatccggttctgc
aagtcgcacatccatgactggggcctgtttgctatggagccaattgctgctgatgagatg
gtgattgagtacgtgggacagaacatcagacaggtgattgccgacatgagggagaagcgc
tatgaggacgagggcatcggaagcagctacatgttccgggtggaccatgacaccatcata
gatgccacaaagtgtggaaacttcgctcgcttcatcaaccacagctgcaatcccaactgc
tacgctaaggtgatcacagtggaggcccaaaagaagattgttatttactccagacaaccc
atcaacgtcaatgaagagatcacctatgactacaagttccccatcgaggatgagaaaatc
ccctgcttgtgtggggcagagaactgtaggggaacgttgaactaa

DBGET integrated database retrieval system