KEGG   Esox lucius (northern pike): 105015016Help
Entry
105015016         CDS       T04894                                 

Gene name
abl1
Definition
(RefSeq) tyrosine-protein kinase ABL1 isoform X1
  KO
K06619  abelson tyrosine-protein kinase 1 [EC:2.7.10.2]
Organism
els  Esox lucius (northern pike)
Pathway
els04012  ErbB signaling pathway
els04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    105015016 (abl1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    105015016 (abl1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:els01001]
    105015016 (abl1)
Enzymes [BR:els01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     105015016 (abl1)
Protein kinases [BR:els01001]
 Non-receptor tyrosine kinases
  ABL family
   105015016 (abl1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase F_actin_bind SH2 SH3_1 SH3_9 SH3_2 SH3_3 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 105015016
NCBI-ProteinID: XP_028981135
LinkDB All DBs
AA seq 1101 aa AA seqDB search
MGQQPGKFVGDQRRPSLPALHFIKGVKREPPRHGNIPCNVFTVHEALQRPDIEPQGLPEA
ARWNSKENLLAGPSENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTK
NGQGWVPSNYITPVNSLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQRSISL
RYEGRVYHYRINTASDGKLYVSSESRFNTLAELVHHHSTVADGLITTLHYPAPKRNKPTI
YGVSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYNLTVAVKTLKEDTMEVEEFLK
EAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTHGNLLDYLRECNREEVNAVVLLYMAT
QISSAMEYLERKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKW
TAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMDRPEGCP
EKVYQLMRACWKWNPAERPSFAETHQAFETMFQESSISDEVEKELGKKGRKGLQGPTQQA
PQLPTKTRTLRRAVDRDGDNPDTVEPEVAVSPMLPRKERPFLDNNLNEDDRLLPKDKDKS
RTSLFNLIKKKKKLAPTPPKRSSSFRETDVLPERRGLAPDHRDNDFNNGPTAFNETHNDL
SKFPGANNNGAAGITNGAPTYPGLLFPSQHARKKGAPVVPSVAGKMATTPPSEEDVVSNS
KRFLRSSSASVMPPGSERTEWKSVTLPRDLHKGHFDSSTFGKPALPRKRANEKPEISTPR
METLTPPPRLPKKSEDQSDEVFKDAEVFKEAERRPLGQGPDSSKTNALQAELLKPNVFPA
LGAAGDECRARRHKHNPDQSSARERAKFQKPKPAPPPPPVSSTKTGKVSRSPTQELASPT
DNRAKASEPSSPCDPTRSPLEGLKKLSTSSKPQPSKTSTSSSSSSSSMSGSTSSPLGFSS
LTSPGDQSSPTAFIPLMNTRRSLRKTRAPPERQPNSAITRDMVLEGTELLRTAIGRNSEQ
TGSHSAVLEAGKNLSKYCMSYVESIQQMRNKFAFREAINKLESSLRELQICPAATGGASG
AQQDFSKLLSSVKEISDIVQR
NT seq 3306 nt NT seq  +upstreamnt  +downstreamnt
atggggcagcagccggggaagtttgttggggaccagaggagacctagtctgccagcactg
cacttcatcaagggggtgaagagggagccaccaagacatggaaacattccctgtaatgtc
ttcactgtgcacgaagctctccagagaccagacattgagccccagggtctgccagaagcg
gcacgctggaactccaaagagaatcttttagctggacccagcgagaatgaccccaacctg
tttgttgccctctatgactttgtggccagtggggataacacactcagcataactaaagga
gagaagctacgagtcctgggttacaaccataatggggagtggtgcgaagcgcagaccaag
aacggccagggctgggtgcccagtaactacatcaccccggtcaacagtttggagaagcac
agctggtaccatgggcccgtgtcgcgcaacgccgccgagtatctgctcagctcggggatc
aacggcagcttcctggtccgggagagcgagagcagcccgggtcagaggtcaatctcgctg
cgctacgagggccgcgtctaccactataggatcaacacggcgtctgacgggaagctctac
gtgtcttctgagagtcgcttcaacacgctggccgagctggtgcaccaccactccacggtg
gccgacgggctgatcaccacgctccactacccggcgcccaaacgcaacaagcccaccatc
tacggcgtgtcgcccaactacgacaagtgggagatggagcgcaccgacatcaccatgaag
cacaagctgggcgggggccagtacggggaggtctacgagggggtctggaagaagtacaac
ctcaccgtggccgtcaagacactcaaggaggacaccatggaggtggaggagttcctgaag
gaggccgctgtcatgaaggagatcaaacaccccaacctggtccagctgctgggcgtgtgc
acgagggagcccccgttctacatcatcacggagttcatgacccacggcaacctgctggac
tacctgagggagtgtaacagggaggaggtcaacgccgtggtgctgctctacatggccacg
caaatctcctccgctatggagtacctggagaggaagaacttcatccacagggacctggcc
gcccgtaactgcctggtgggggagaaccacctggtgaaggtggcagacttcgggctgagc
aggctgatgacgggcgacacgtacacggcgcacgccggagccaagttccccatcaagtgg
acggcccccgaaagcctggcctacaacaagttttccatcaagtcagacgtctgggcattc
ggagtgttgctatgggagatcgccacctatggcatgtctccatacccgggcatagacctg
tcccaggtgtatgagctcctggagaaggactaccgcatggatcggcccgagggatgccca
gagaaggtctaccagcttatgagggcctgctggaagtggaaccccgcagagaggccgtca
tttgctgagacccaccaggcatttgagaccatgttccaggaatccagcatctccgacgag
gtggagaaggagctgggcaagaaagggaggaaggggttgcagggccccacccagcaggct
ccacagttacccaccaagacccggaccctccggagagctgtggaccgagacggagacaac
cctgacaccgtggaaccggaggtggccgtgtcgcccatgcttcccaggaaggagcgcccc
ttcctggacaacaacctgaacgaggacgaccgcctcctgcccaaagacaaggacaagtct
cgcaccagcctcttcaacctcatcaagaagaagaagaagctggcgcccacgccgcccaaa
cgcagcagctctttccgagagacggacgtgctcccggagagacgaggcctggcgcctgac
cacagagacaacgacttcaacaacggccccacagccttcaatgaaacgcacaacgatctc
agcaagtttccgggcgccaacaacaacggggcagccggtattaccaacggggcccccact
tacccgggcctcctgttcccctctcagcatgccaggaagaagggggcgccagtggtgccc
agtgtggcagggaagatggccaccactccgcccagtgaggaggacgtagtgtccaactcc
aaacgctttctgcgttcctcgtcggcctccgtcatgcccccgggctcggagcgcacagag
tggaagtccgtcacgctgccccgggacctgcacaaaggccactttgactctagcaccttt
ggtaagcccgccctgccccgcaagagggccaatgagaagccagagatcagcacccctcgt
atggagaccctcacccccccaccccgcctgcccaagaagtcagaggaccagtcagatgag
gtgttcaaggatgcggaggtgtttaaagaggcagagaggaggcctctggggcagggacca
gacagctccaaaaccaacgctctgcaggccgagttgctgaagccaaatgtttttcctgct
ctgggggcagccggggacgagtgcagggcccgccgacacaaacacaacccggaccaatcc
agtgccagggagagagccaagttccagaagcccaagccggctccccctcctccccctgtc
tccagcaccaagacgggcaaggtctcacgcagccccactcaggagctggcctctcccact
gacaacagagccaaggcttcagagccatccagcccctgtgacccaacccgctctcccctg
gagggtctcaagaaactcagcacctcctccaaaccgcagccttccaagacctccacctcc
tcttcctcctcctcttcctcaatgtcgggctccacatccagccccctgggcttctcttcc
ctcacctccccaggagaccagtcctctcccacagccttcatccccctcatgaacacccgc
cgctccctgaggaagacacgcgcgcccccggagcgccagcccaactccgccatcactagg
gacatggtcctggagggcacggagctgctgcgcactgccattggacgcaactcggagcag
acgggtagccacagcgcagtcctggaggcggggaagaacctgtccaagtactgcatgagc
tacgtggagtccatccagcagatgaggaacaagttcgccttccgcgaagccatcaacaag
ctggagagcagcttgcgagagctgcagatctgcccggctgccaccgggggcgccagcgga
gcacaacaggacttcagcaagctgctctcgtccgtcaaagagatcagtgacattgttcag
aggtag

DBGET integrated database retrieval system