KEGG   Esox lucius (northern pike): 105015221
Entry
105015221         CDS       T04894                                 

Gene name
grk3
Definition
(RefSeq) beta-adrenergic receptor kinase 2
  KO
K00910  beta-adrenergic-receptor kinase [EC:2.7.11.15]
Organism
els  Esox lucius (northern pike)
Pathway
els04144  Endocytosis
els04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    105015221 (grk3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    105015221 (grk3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:els01001]
    105015221 (grk3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:els04147]
    105015221 (grk3)
Enzymes [BR:els01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.15  beta-adrenergic-receptor kinase
     105015221 (grk3)
Protein kinases [BR:els01001]
 Serine/threonine kinases: AGC group
  GRK family [OT]
   105015221 (grk3)
Exosome [BR:els04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   105015221 (grk3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RGS PH Kinase-like Pkinase_fungal HTH_WhiA
Other DBs
NCBI-GeneID: 105015221
NCBI-ProteinID: XP_012992642
LinkDB
AA seq 688 aa
MADLEAVLADVSYLMAMEKSKSTPAARASKKIILPEPSIRSVMQKYLDERDELTFDKIFN
QKIGFLLFKDFCLNEIDEAVPQLYFYEEIKDYEKLDSEEERLCRSRLIYDRYIMKELLSC
SHPFSKKAVDHVQTHLAKKQVPPSLFQPYIVEICDSLRGVIFRKFIESDKFTRFCQWKNV
ELNIHLTMNDFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKRIKMKQGETLALNER
IMLSLVSTGDCPFIVCMTYAFHTPDKLCFILDLMNGGDLHYHLSQHGVFSEKEMRFYAAE
IILGLEHMHNRFVVYRDLKPANILLDEHGHVRISDLGLACDFSKKKPHASVGTHGYMAPE
VLQKGTAYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEIDRMTLTMNVELPDSFSVE
LKGLLEGLLQRDVVKRLGCLGRGAPEVKEHLFFKGIDWQQVYLQKYSPPLIPPRGEVNAA
DAFDIGSFDEEDTKGIKLLDSDQELYKNFPLVISERWQQEVAETVYEAVNSDTDKNEARK
RAKNKQLGHEEDYALGKDCIMHGYMLKLGNPFLTQWQRRYFYLFPNRVEWRGEGESRQNL
LTMEQIVTVEETQIKDKKCILLRIKGGKQFVLQCESDPEFVQWKKELTEAFTEAQKLLRR
APKVIGKGRAGVVELSKPPLTHRNSNGL
NT seq 2067 nt   +upstreamnt  +downstreamnt
atggcggacctcgaagcagttctcgccgatgtcagctatttgatggcgatggagaagagc
aaatctactccagcggcccgtgcaagcaagaaaatcatactgcctgaacccagtattcgc
agtgtaatgcagaagtaccttgacgagcgagatgagctgacgtttgacaaaatcttcaac
cagaagatcggttttctgctcttcaaggatttctgtttgaatgagatagacgaggccgta
cctcagctctatttctatgaagagatcaaggattatgaaaaattggactctgaagaggag
aggttgtgtcgtagcagactgatctacgaccgatacatcatgaaggaactcctctcctgc
tcacatcccttttctaagaaggcggtagaccacgttcagacgcacctggccaagaaacaa
gttcctccctctttatttcagccatacatagtcgagatctgtgacagcctgcgaggggtg
atcttccggaagttcatagagagtgacaagtttactcgtttctgccaatggaagaatgtg
gagctgaacatccatttgacgatgaatgacttcagtgtccaccgtatcattggtcggggg
ggtttcggtgaggtgtacggctgcaggaaggctgacaccggcaagatgtatgccatgaag
tgtttggataagaagaggatcaagatgaaacagggagagactctggctctgaatgagaga
atcatgctgtcacttgtcagcacaggggactgtccgtttattgtgtgtatgacgtacgcc
ttccatacaccagacaaactgtgcttcattctggacctgatgaacggaggggacctacac
taccacttgtctcaacacggtgtgttcagtgaaaaggagatgcgtttctatgcagcggag
atcatcctgggactagaacacatgcacaaccgcttcgtagtgtacagagacctgaagcct
gccaacatcctgctggatgaacatggtcatgtacgtatttcagacctgggtctggcctgc
gacttctccaagaagaaaccccatgccagcgttggtacccatggatacatggctccagag
gttctccagaaggggacggcgtatgacagcagcgccgactggttctccctgggctgcatg
ctgttcaaactgcttcgggggcacagtcccttcagacaacacaagaccaaagacaaacat
gagattgaccgtatgacactcaccatgaatgtcgagttgccggactcgttctctgtggag
ctgaagggtctgttggagggtctgctgcagagagatgttgtcaagagactgggctgcctg
ggacgaggggccccagaggtaaaggagcatctgttcttcaaaggcatcgactggcagcaa
gtgtatctccagaagtattctcccccactcatcccccccaggggagaggtcaatgccgca
gatgcttttgacattggctcctttgacgaggaggacaccaagggtatcaagttgttggac
agtgaccaggagttgtataagaactttcccctggtcatctcagaacgctggcaacaggag
gtggctgagactgtgtatgaggcggtcaactctgacacggataagaacgaggcccgcaag
agggccaagaacaaacagctgggccacgaggaagactatgcccttgggaaggactgcata
atgcatggatacatgttgaagctggggaaccccttcctgacacagtggcagcggagatac
ttctacctgttccccaaccgagtggagtggaggggggagggagagtcacggcaaaacctg
ctgacaatggagcagattgtgactgtggaggagactcagataaaagataagaagtgcatc
ctgctgcgcattaaaggagggaagcagtttgtcctgcagtgtgagagtgacccagagttt
gtccagtggaagaaggagttgaccgaggcatttacggaggcccagaagctcctgcgccgt
gcgcccaaggtcatcgggaaggggcgggctggcgtggtggagctctccaaacctcctctc
acacaccgcaacagcaatggcctgtag

DBGET integrated database retrieval system