KEGG   Esox lucius (northern pike): 105015651
Entry
105015651         CDS       T04894                                 

Gene name
akt1
Definition
(RefSeq) RAC-alpha serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
els  Esox lucius (northern pike)
Pathway
els04010  MAPK signaling pathway
els04012  ErbB signaling pathway
els04068  FoxO signaling pathway
els04140  Autophagy - animal
els04150  mTOR signaling pathway
els04210  Apoptosis
els04218  Cellular senescence
els04261  Adrenergic signaling in cardiomyocytes
els04370  VEGF signaling pathway
els04371  Apelin signaling pathway
els04510  Focal adhesion
els04620  Toll-like receptor signaling pathway
els04625  C-type lectin receptor signaling pathway
els04910  Insulin signaling pathway
els04914  Progesterone-mediated oocyte maturation
els04920  Adipocytokine signaling pathway
els05132  Salmonella infection
els05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105015651 (akt1)
   04012 ErbB signaling pathway
    105015651 (akt1)
   04370 VEGF signaling pathway
    105015651 (akt1)
   04371 Apelin signaling pathway
    105015651 (akt1)
   04068 FoxO signaling pathway
    105015651 (akt1)
   04150 mTOR signaling pathway
    105015651 (akt1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105015651 (akt1)
  09143 Cell growth and death
   04210 Apoptosis
    105015651 (akt1)
   04218 Cellular senescence
    105015651 (akt1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105015651 (akt1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    105015651 (akt1)
   04625 C-type lectin receptor signaling pathway
    105015651 (akt1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    105015651 (akt1)
   04920 Adipocytokine signaling pathway
    105015651 (akt1)
   04914 Progesterone-mediated oocyte maturation
    105015651 (akt1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    105015651 (akt1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    105015651 (akt1)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    105015651 (akt1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:els01001]
    105015651 (akt1)
Enzymes [BR:els01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     105015651 (akt1)
Protein kinases [BR:els01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   105015651 (akt1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like PH_11 Seadorna_VP7 FTA2 Pkinase_fungal
Other DBs
NCBI-GeneID: 105015651
NCBI-ProteinID: XP_010877257
LinkDB
AA seq 473 aa
MAEVAIVKEGWLHKRGEYIKTWRPRYFLLKSDGTFIGYKERPQDVDALETPLNNFSVAQC
QLMKTERPKPNTFIIRCLQWTTVIERTFHVETPEEREEWTKAIQAVADGLQKQEEEMMDS
SPDPMDMEMYLTKPRLKVTMHDFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIV
AKDEVAHTLTENRVLQNSKHPFLTGLKYSFQTHDRLCFVMEYANGGELFFHLSRDRVFSE
ERARFYGAEIVSALDYLHAERNVVYRDLKLENLMLDKDGHIKITDFGLCKEGITDGATMK
TFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEDIR
FPRTLGPDGRSLLSGLLKKDPKQRLGGGQDDAKEIMQHKFFAGIEWQDVYEKKLIPPFKP
QVTSETDTRYFDEEFTAQTITITPPGQDDHMESFDSERRPHFPQFSYSASGTA
NT seq 1422 nt   +upstreamnt  +downstreamnt
atggccgaggtggcgattgtgaaagagggatggctccacaaaagaggagaatacatcaag
acatggaggccgaggtactttctactcaagagtgacggtacattcattggctacaaggag
cgaccacaagatgttgatgcacttgaaacacctctaaataacttctcggtagcacagtgc
cagctgatgaagacagagagaccgaagcccaacacatttatcatccgctgcctgcagtgg
accactgtgatcgagcgcaccttccacgtggagacccccgaggagagggaagaatggaca
aaagcgattcaggctgttgcagatggcttacagaaacaggaggaggagatgatggactcc
tccccagacccaatggacatggagatgtacctgaccaaaccaagactcaaagtgactatg
catgactttgaatacctcaaactcctcggaaaaggcactttcggcaaagtaatcttggta
aaggagaaggccactggacgctactacgccatgaaaatcctgaagaaggaagtgatcgta
gcaaaagatgaagtggcgcacacactcacagaaaaccgagtgctccagaattcgaagcat
ccattcttgacgggcctaaaatactctttccagacccatgaccggttgtgttttgtcatg
gagtatgcaaacggcggagagctgttcttccacctgtcccgagaccgggtgttctctgag
gagcgggcacggttctacggggcagagatagtgtcagcactggactacctccatgccgag
aggaacgttgtctacagagacctgaagctggaaaatctcatgctggacaaagacggacac
ataaagatcaccgacttcggcctgtgtaaagagggcatcacggacggggcgacgatgaag
accttctgtgggacgcctgagtacctggctccggaggtcctggaggacaacgactacggc
cgggcggtggactggtggggtctgggcgtggtcatgtacgagatgatgtgtggccggctg
cccttctacaaccaggaccacgagaagctgtttgagctcatcctcatggaggacatccgt
ttcccacgcaccctgggccctgacggacgctctctcctgtctggcctgctcaagaaagac
cccaagcagcggttaggtggtggacaggatgatgctaaggagatcatgcaacacaaattc
tttgctgggattgaatggcaagatgtctatgagaagaagctgatcccgcccttcaagccc
caggttacctcagaaacggacacgcggtattttgatgaggagttcacagcacagaccatc
actattacgccgccgggacaagatgaccacatggagtcgtttgatagtgaacggagaccc
catttcccacagttctcctactctgcgagtgggacagcctaa

KEGG   Esox lucius (northern pike): 105017614
Entry
105017614         CDS       T04894                                 

Definition
(RefSeq) RAC-alpha serine/threonine-protein kinase isoform X1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
els  Esox lucius (northern pike)
Pathway
els04010  MAPK signaling pathway
els04012  ErbB signaling pathway
els04068  FoxO signaling pathway
els04140  Autophagy - animal
els04150  mTOR signaling pathway
els04210  Apoptosis
els04218  Cellular senescence
els04261  Adrenergic signaling in cardiomyocytes
els04370  VEGF signaling pathway
els04371  Apelin signaling pathway
els04510  Focal adhesion
els04620  Toll-like receptor signaling pathway
els04625  C-type lectin receptor signaling pathway
els04910  Insulin signaling pathway
els04914  Progesterone-mediated oocyte maturation
els04920  Adipocytokine signaling pathway
els05132  Salmonella infection
els05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105017614
   04012 ErbB signaling pathway
    105017614
   04370 VEGF signaling pathway
    105017614
   04371 Apelin signaling pathway
    105017614
   04068 FoxO signaling pathway
    105017614
   04150 mTOR signaling pathway
    105017614
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105017614
  09143 Cell growth and death
   04210 Apoptosis
    105017614
   04218 Cellular senescence
    105017614
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105017614
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    105017614
   04625 C-type lectin receptor signaling pathway
    105017614
  09152 Endocrine system
   04910 Insulin signaling pathway
    105017614
   04920 Adipocytokine signaling pathway
    105017614
   04914 Progesterone-mediated oocyte maturation
    105017614
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    105017614
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    105017614
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    105017614
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:els01001]
    105017614
Enzymes [BR:els01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     105017614
Protein kinases [BR:els01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   105017614
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C FTA2 Seadorna_VP7 Pkinase_fungal
Other DBs
NCBI-GeneID: 105017614
NCBI-ProteinID: XP_010880628
UniProt: A0A3P8XGA0
LinkDB
AA seq 474 aa
MGEVVIVKEGWLHKRGEYIKTWRPRYFLLKSDGTFIGYKERPQDVDQLETPLNNFSVAPE
CQLMKTERPKPNTFIIRCLQWTTVIERTFHVESPEEREQWTKAIQEVADGLQKQEEERMD
SSPDPMDMEMYLTKPKLKVTMHDFEYLKLLGKGTFGKVILVKEKATGKYYAMKILKKEVI
VAKDEVAHTLTENRVLQNSKHPFLTGLKYSFQTHDRLCFVMEYANGGELFFHLSRDRVFS
EERARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGIKDGATM
KTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEI
RFPRTLGPEGKSLLSGLLKKDPKQRLGGGPDDAKEIMQHKFFAGIEWKDVYEKKLVPPFK
PQVTSETDTRYFDVEFTGQTITITPPGQDDNMESFDSDRRPHFPQFSYSASGTA
NT seq 1425 nt   +upstreamnt  +downstreamnt
atgggcgaagtagtcattgtaaaggagggatggttacacaaacgaggagaatacataaag
acttggagacccaggtattttttgctaaagagtgatggtacatttattgggtacaaggag
cgaccacaagacgtagaccaactggagacgccactcaataacttctcagtagcaccagaa
tgtcagctgatgaaaaccgagcgccccaagcccaacacgttcatcatccggtgcctacag
tggaccaccgtcatcgagcgcaccttccacgtggagagcccggaggagagggagcagtgg
acgaaggccatccaggaggtggctgatgggctgcagaaacaggaggaggagaggatggat
tcctccccagatcccatggatatggagatgtacctcaccaaacccaaacttaaagtgact
atgcatgactttgaatacctcaaactcttgggtaaaggcacttttggaaaggttatcctg
gtgaaggaaaaagccacaggaaaatactacgctatgaaaatcctcaagaaagaagtgatt
gtagcaaaggatgaagtagcacacacactcactgaaaacagagtactgcagaactccaaa
caccccttcttaacgggtcttaagtattccttccagactcacgaccgcttgtgttttgtc
atggagtatgcaaatggaggagagctgttcttccacctatcacgagaccgcgtcttctcc
gaggagagggcccggttttacggtgcagagattgtgtctgcgctggactacctccactct
gagaaaaacgtggtttatcgggacctgaagctggaaaacctgatgctggacaaggacggc
cacatcaagatcacagactttggcctgtgcaaggagggcatcaaggacggagctaccatg
aagaccttctgcgggacgccggagtacctggcccctgaggtcctggaggacaacgactac
ggccgggcggtggactggtggggtctgggcgtggtcatgtacgagatgatgtgtggccgg
ctgcccttctacaaccaggaccacgagaagctgtttgagctgatcctgatggaggagatc
cgcttcccccgaactctgggcccggaggggaagtctctgctttctggcttgctgaagaag
gaccccaagcaaaggttaggtggaggacctgatgatgccaaggagataatgcagcacaag
ttcttcgcagggatcgagtggaaggacgtgtatgagaagaagctggtcccgccctttaag
ccccaggtcacctcagaaaccgacacccgctattttgacgtggagttcacagggcagact
atcaccatcacccctccaggacaagatgacaacatggagtctttcgacagcgacaggaga
ccccatttcccccagttctcctattctgcaagtgggacagcctga

KEGG   Esox lucius (northern pike): 105021234
Entry
105021234         CDS       T04894                                 

Gene name
akt3
Definition
(RefSeq) RAC-gamma serine/threonine-protein kinase isoform X1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
els  Esox lucius (northern pike)
Pathway
els04010  MAPK signaling pathway
els04012  ErbB signaling pathway
els04068  FoxO signaling pathway
els04140  Autophagy - animal
els04150  mTOR signaling pathway
els04210  Apoptosis
els04218  Cellular senescence
els04261  Adrenergic signaling in cardiomyocytes
els04370  VEGF signaling pathway
els04371  Apelin signaling pathway
els04510  Focal adhesion
els04620  Toll-like receptor signaling pathway
els04625  C-type lectin receptor signaling pathway
els04910  Insulin signaling pathway
els04914  Progesterone-mediated oocyte maturation
els04920  Adipocytokine signaling pathway
els05132  Salmonella infection
els05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105021234 (akt3)
   04012 ErbB signaling pathway
    105021234 (akt3)
   04370 VEGF signaling pathway
    105021234 (akt3)
   04371 Apelin signaling pathway
    105021234 (akt3)
   04068 FoxO signaling pathway
    105021234 (akt3)
   04150 mTOR signaling pathway
    105021234 (akt3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105021234 (akt3)
  09143 Cell growth and death
   04210 Apoptosis
    105021234 (akt3)
   04218 Cellular senescence
    105021234 (akt3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105021234 (akt3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    105021234 (akt3)
   04625 C-type lectin receptor signaling pathway
    105021234 (akt3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    105021234 (akt3)
   04920 Adipocytokine signaling pathway
    105021234 (akt3)
   04914 Progesterone-mediated oocyte maturation
    105021234 (akt3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    105021234 (akt3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    105021234 (akt3)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    105021234 (akt3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:els01001]
    105021234 (akt3)
Enzymes [BR:els01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     105021234 (akt3)
Protein kinases [BR:els01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   105021234 (akt3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C FTA2 APH
Other DBs
NCBI-GeneID: 105021234
NCBI-ProteinID: XP_010887056
UniProt: A0A3P8Y9Q5
LinkDB
AA seq 480 aa
MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDADLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEERDEWTDAIQIVADKLQRQEEERIQCS
PTSQIDNIGELEEMDTSTSHHKRKTMNDFDYLKLLGKGTFGKVILVREKANGKYYAMKIL
KKEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSR
ERVFSEDRTRFYGAEIVSALDYLHSAKIVYRDLKLENLMLDKDGHVKITDFGLCKEGITD
AATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELIL
MEDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFAGIDWQDVYDKKLL
PPFKPQVSSETDTRYFDEEFTAQTITITPPEKFDEDGMDCMDNERRPHFPQFSYSASGRE
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgagcgatgtcaccatcgtcaaagaaggctgggtgcagaaacggggagaatatatcaag
aactggagacctcgctacttcctgctgaaaacagatggctccttcataggttacaaggag
aagccacaggacgcagacctaccctatcctctcaataacttctctgttgcaaaatgccag
ctgatgaagacagaacgaccaaagcccaacacattcatcatccgatgtcttcagtggacc
accgtcatagaacggaccttccatgtcgacacgccggaggaaagggatgagtggacggat
gccatccagatagtagcagacaaactccaaagacaggaggaggagaggatccaatgcagt
cccacgtctcagatagacaacatcggggagctggaggagatggacacctccaccagccac
cacaaacggaagacaatgaatgactttgactacttgaagctactgggaaaaggcactttc
ggtaaagtaattctagtaagagagaaggctaacggcaaatattatgcaatgaagattttg
aagaaagaagtgattattgcaaaggatgaagtggcacacacactcacagagagcagagta
ttaaaaaacactaggcacccattcttaacctctttgaagtattcgttccagactaaggac
cgcctgtgctttgtaatggaatatgtcaatggtggagagctgtttttccatttgtcgaga
gagcgggtgttctctgaggaccgcacgcgattctacggcgctgaaatagtctcggctctg
gactacctgcactccgccaagattgtgtaccgggatctcaagttggagaacctaatgcta
gataaagatggacatgtgaaaatcacagactttgggctctgcaaggaaggaatcacagat
gctgctactatgaagactttctgtggtacgccagagtacctcgctccagaggtgctggag
gacaatgactatggccgggcagtggactggtggggtctgggcgtggtcatgtacgagatg
atgtgtggtcggctgcctttctacaaccaggaccacgagaagctgttcgagctcatcctc
atggaggacatcaagttcccgcgcacactgtcgtcagatgctaagtcactgctatcagga
cttctcataaaagaccccaacaaaagacttggaggaggtccagatgacgcaaaagaaatc
atgcgacacagtttctttgctggaatcgactggcaagatgtttatgataagaagctccta
cctccctttaagcctcaggtgtcatcggagacggataccaggtattttgacgaagaattc
accgcacagacgattacaataactcccccagagaaatttgatgaagacgggatggattgt
atggacaacgaaaggaggccacacttcccccaattttcctactccgcaagtgggagggaa
tga

KEGG   Esox lucius (northern pike): 105021541
Entry
105021541         CDS       T04894                                 

Definition
(RefSeq) RAC-gamma serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
els  Esox lucius (northern pike)
Pathway
els04010  MAPK signaling pathway
els04012  ErbB signaling pathway
els04068  FoxO signaling pathway
els04140  Autophagy - animal
els04150  mTOR signaling pathway
els04210  Apoptosis
els04218  Cellular senescence
els04261  Adrenergic signaling in cardiomyocytes
els04370  VEGF signaling pathway
els04371  Apelin signaling pathway
els04510  Focal adhesion
els04620  Toll-like receptor signaling pathway
els04625  C-type lectin receptor signaling pathway
els04910  Insulin signaling pathway
els04914  Progesterone-mediated oocyte maturation
els04920  Adipocytokine signaling pathway
els05132  Salmonella infection
els05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105021541
   04012 ErbB signaling pathway
    105021541
   04370 VEGF signaling pathway
    105021541
   04371 Apelin signaling pathway
    105021541
   04068 FoxO signaling pathway
    105021541
   04150 mTOR signaling pathway
    105021541
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105021541
  09143 Cell growth and death
   04210 Apoptosis
    105021541
   04218 Cellular senescence
    105021541
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105021541
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    105021541
   04625 C-type lectin receptor signaling pathway
    105021541
  09152 Endocrine system
   04910 Insulin signaling pathway
    105021541
   04920 Adipocytokine signaling pathway
    105021541
   04914 Progesterone-mediated oocyte maturation
    105021541
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    105021541
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    105021541
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    105021541
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:els01001]
    105021541
Enzymes [BR:els01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     105021541
Protein kinases [BR:els01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   105021541
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C APH
Other DBs
NCBI-GeneID: 105021541
NCBI-ProteinID: XP_010887598
LinkDB
AA seq 480 aa
MSDLNVVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKDKPQDADLAYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPNERDEWAEAIQTVADSLASQEEEGLICC
PTSQIENEVNEEEMDTSTSHHKRKTMNDFDYLKLLGKGTFGKVILVKEKASGTYYAMKIL
KKEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSR
ERVFSEDRTRFYGAEIVSALDYLHSAKIVYRDLKLENLMLDKDGHVKITDFGLCKEGITD
AATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELIL
MEEIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFVAVDWQDVYDKKLV
PPFMPQVSSETDTRYFDEEFTAQTITITPPEKFDEDGMSESDSERRPHFPQFSYSASGRE
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgagcgacctgaacgttgtcaaggaaggctgggttcaaaagagaggtgagtacataaag
aactggaggccacgctacttcctgctgaagacggacggctcctttattggctacaaggac
aaaccacaagatgctgacctggcttatcccctcaacaacttctccgtagcaaaatgccag
ctgatgaagacggagaggcccaagcccaacacgttcatcatccgctgtttgcagtggacc
actgtcattgagagaaccttccacgtggacacgcccaatgagagggacgagtgggcggag
gccatccagactgtggccgactccctggccagccaggaggaggaggggctcatctgctgc
cccacgtcgcagattgagaacgaggtcaacgaggaggagatggacacctccaccagccac
cacaaacggaagacaatgaatgactttgactatctgaaactactgggcaagggcactttc
gggaaagtcattttggtcaaggagaaggcgagcggaacgtattatgccatgaagatcctg
aagaaagaagtcatcatcgccaaggatgaagtcgctcatacactcacagaaagcagagtt
ttaaaaaacacccgacatccgttcctaacttctctgaagtattcctttcagaccaaggac
cggttgtgcttcgtcatggagtatgtgaatggaggagagctattttttcatttgtcacga
gagcgagtgttctctgaggaccgcacacgtttctatggcgccgagatcgtctcagcttta
gactacctgcactctgctaagatagtgtaccgcgatcttaagctggaaaacctgatgctg
gataaagacggccacgtcaaaatcacagactttggcctctgcaaagaaggcatcaccgat
gcggcaaccatgaagaccttctgtggcacgccggagtacctggcaccagaggttctggag
gacaatgactatggccgggcggtggactggtggggtctgggtgtggtcatgtatgagatg
atgtgtggccggctgcccttctacaaccaggaccatgagaagctgtttgagctcattctc
atggaggagattaagttcccacgcacgctctcctccgacgccaagtccctgctttccggc
ctgctcatcaaggaccctaacaaacggctcggcggcgggccagatgacgccaaggagatc
atgcgccacagcttcttcgtggcggtagattggcaagacgtctacgacaagaagttggtc
ccgcccttcatgccccaagtctcctcggagactgacacccggtattttgacgaggagttc
acggcacagacgatcaccatcactccaccggaaaaatttgatgaggatggaatgagcgag
agtgacagcgaacggaggcctcatttcccacaattctcgtattcggccagcggacgagag
tga

KEGG   Esox lucius (northern pike): 105023568
Entry
105023568         CDS       T04894                                 

Gene name
akt2
Definition
(RefSeq) RAC-beta serine/threonine-protein kinase isoform X1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
els  Esox lucius (northern pike)
Pathway
els04010  MAPK signaling pathway
els04012  ErbB signaling pathway
els04068  FoxO signaling pathway
els04140  Autophagy - animal
els04150  mTOR signaling pathway
els04210  Apoptosis
els04218  Cellular senescence
els04261  Adrenergic signaling in cardiomyocytes
els04370  VEGF signaling pathway
els04371  Apelin signaling pathway
els04510  Focal adhesion
els04620  Toll-like receptor signaling pathway
els04625  C-type lectin receptor signaling pathway
els04910  Insulin signaling pathway
els04914  Progesterone-mediated oocyte maturation
els04920  Adipocytokine signaling pathway
els05132  Salmonella infection
els05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105023568 (akt2)
   04012 ErbB signaling pathway
    105023568 (akt2)
   04370 VEGF signaling pathway
    105023568 (akt2)
   04371 Apelin signaling pathway
    105023568 (akt2)
   04068 FoxO signaling pathway
    105023568 (akt2)
   04150 mTOR signaling pathway
    105023568 (akt2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105023568 (akt2)
  09143 Cell growth and death
   04210 Apoptosis
    105023568 (akt2)
   04218 Cellular senescence
    105023568 (akt2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105023568 (akt2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    105023568 (akt2)
   04625 C-type lectin receptor signaling pathway
    105023568 (akt2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    105023568 (akt2)
   04920 Adipocytokine signaling pathway
    105023568 (akt2)
   04914 Progesterone-mediated oocyte maturation
    105023568 (akt2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    105023568 (akt2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    105023568 (akt2)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    105023568 (akt2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:els01001]
    105023568 (akt2)
Enzymes [BR:els01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     105023568 (akt2)
Protein kinases [BR:els01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   105023568 (akt2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C PH_11
Other DBs
NCBI-GeneID: 105023568
NCBI-ProteinID: XP_010891178
LinkDB
AA seq 521 aa
MKMSDTSADVLHQRCQSSSYTPPLPAPPCDLTLSSVLFPSMNEITVVREGWLHKRGEYIK
TWRPRYFILKSDGSFIGYKEKPEMSSDHSLPPLNNFSVAECQLMKTERPRPNTFVIRCLQ
WTTVIERTFHVESHEEREEWMRSIQAVANGLKTREEDAPMDITFGSPSDSSGMEEMEVAM
SKSRNRVTMSDFDYLKLLGKGTFGKVILVKEKATGMYYAMKILRKEVIIAKDEVAHTVTE
SRVLQNTRHPFLTTLKYAFQTHDRLCFVMEYANGGELFFHLSRDRVFTEDRARFYGAEIV
SALEYLHSRDVVYRDLKLENLMLDKDGHIKITDFGLCKEGITDGATMKTFCGTPEYLAPE
VLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELILMEEIRFPKNLAPEAKAL
LAGLLKKDPKQRLGGGQEDAKEVMTHKFFTTINWQDVVERKLLPPFKPQVTSETDTRYFD
DEFTAQTITVTPPDKYDSLDAEDPDQPTHFPQFSYSASIRE
NT seq 1566 nt   +upstreamnt  +downstreamnt
atgaaaatgagcgacacttctgctgacgtccttcaccaacgttgtcaaagctcctcttac
acccctcccctccctgctcctccctgtgacctgaccctgagctccgtcctcttccccagc
atgaatgaaatcacagtggtcagagagggctggctccataagagaggagagtacattaag
acctggaggccgaggtacttcatcctaaagagcgatggctccttcatcggctacaaggag
aagccagagatgtcatccgaccacagcctcccaccgcttaacaacttctctgtagcagag
tgccagctaatgaagacagaacggccaaggcccaatacatttgtcatccgctgcctacag
tggaccaccgtcattgagcgcacgttccacgtggagagccacgaggaaagggaggaatgg
atgcggtcaatccaagcggtggctaacggtctgaagacgcgagaggaagatgcacccatg
gacatcacgtttggctccccaagtgatagcagcggtatggaggagatggaggtggccatg
tccaagtcacgcaacagagtgaccatgagtgactttgactacctgaagctgctggggaag
gggacttttggtaaggtgatcctggtcaaggagaaggccactgggatgtactacgccatg
aaaatcctacggaaagaagtcatcattgctaaggacgaggtagcacacacagtaacagaa
agcagagtccttcagaacacaagacaccctttcctgacgacactaaaatacgccttccaa
acacacgaccggctctgctttgtgatggagtatgcaaacggaggagagctattcttccac
ctgtcgcgggaccgcgtgttcacggaagacagggcacggttctacggtgcagagattgtg
tcggcgctggagtaccttcactcacgggatgttgtctacagggacctcaagctggagaac
cttatgctggataaagacggacacataaagattacagattttggactgtgtaaagagggg
atcacggacggggccaccatgaagaccttctgtggtactccagaataccttgcacctgag
gtcttggaggacaacgactacggccgggccgtggactggtggggtctgggtgtggtcatg
tatgagatgatgtgtggtcgactgccattctacaaccaggaccatgagcggttgtttgag
ctcatcctcatggaggagatccgcttccccaagaacctggccccagaagccaaggccctg
cttgctggactactcaaaaaggaccccaagcagaggcttggaggtgggcaagaagacgcc
aaagaagtgatgacacacaagttcttcaccacaatcaactggcaggatgtggttgagagg
aagttactgcctccctttaagccccaggtgacgtcagagacggacacgcgctactttgac
gacgagttcacggcacagaccatcactgtaacgcccccggacaagtatgacagtttagat
gcagaagacccagaccagcccacgcatttccctcagttctcttactccgccagcatacgg
gagtga

KEGG   Esox lucius (northern pike): 105024916
Entry
105024916         CDS       T04894                                 

Definition
(RefSeq) RAC-beta serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
els  Esox lucius (northern pike)
Pathway
els04010  MAPK signaling pathway
els04012  ErbB signaling pathway
els04068  FoxO signaling pathway
els04140  Autophagy - animal
els04150  mTOR signaling pathway
els04210  Apoptosis
els04218  Cellular senescence
els04261  Adrenergic signaling in cardiomyocytes
els04370  VEGF signaling pathway
els04371  Apelin signaling pathway
els04510  Focal adhesion
els04620  Toll-like receptor signaling pathway
els04625  C-type lectin receptor signaling pathway
els04910  Insulin signaling pathway
els04914  Progesterone-mediated oocyte maturation
els04920  Adipocytokine signaling pathway
els05132  Salmonella infection
els05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105024916
   04012 ErbB signaling pathway
    105024916
   04370 VEGF signaling pathway
    105024916
   04371 Apelin signaling pathway
    105024916
   04068 FoxO signaling pathway
    105024916
   04150 mTOR signaling pathway
    105024916
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105024916
  09143 Cell growth and death
   04210 Apoptosis
    105024916
   04218 Cellular senescence
    105024916
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105024916
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    105024916
   04625 C-type lectin receptor signaling pathway
    105024916
  09152 Endocrine system
   04910 Insulin signaling pathway
    105024916
   04920 Adipocytokine signaling pathway
    105024916
   04914 Progesterone-mediated oocyte maturation
    105024916
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    105024916
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    105024916
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    105024916
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:els01001]
    105024916
Enzymes [BR:els01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     105024916
Protein kinases [BR:els01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   105024916
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like PH_11
Other DBs
NCBI-GeneID: 105024916
NCBI-ProteinID: XP_010893516
UniProt: A0A3P8ZBC9
LinkDB
AA seq 478 aa
MNEVNVVREGWLHKRGEYIKTWRPRYFILKSDGSFIGYKEKPELSDQSLPPLNNFSVGEC
QLMKTERPKPNTFVIRCLQWTTVIERTFHVESNAEREEWIRAIQAVANGLKVREEEEPMD
LFGSPSDSSLEEMEVAMSKTRSKVTMSDFDYLKLLGKGTFGKVILVKEKATGMHYAMKIL
RKEVIIAKDEVAHTVTESRVLQNTRHPFLTTLKYAFQTHDRLCFVMEYANGGELFFHLSR
DRVFTEDRARFYGAEIVSALEYLHSRDVVYRDLKLENLMLDNDGHIKITDFGLCKEGITD
GATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELIL
MEEIRFPRNLAPEGKALLAGLLKKDPKQRLGGGPDDAKDVMSHKFFSSINWQDVVDRKLT
PPFKPQVTSETDTRYFDDEFTAQTITVTPPDKYDNLDCEDPNQPAHFPQFSYSASIRE
NT seq 1437 nt   +upstreamnt  +downstreamnt
atgaatgaagtcaacgtagtcagagaaggatggctccacaaaagaggtgagtacatcaag
acttggcggccacgttacttcatcttgaaaagtgacggctcattcatcggctacaaagag
aagccagagttgtccgaccagagcttgcccccactcaacaacttctcagttggagagtgc
cagctgatgaagacagagcgacccaagcccaacacgtttgttatccgctgcctgcagtgg
accactgtcattgaacggaccttccacgtagaaagcaatgcagagagagaggagtggata
cgtgccatccaggcggtggccaatgggctgaaggtgcgagaggaggaggagcctatggac
ctgtttggctctcccagtgacagcagcctggaggagatggaggtggccatgtccaagacc
cgctccaaagtgacgatgagtgactttgactacctgaaactgctgggaaagggcacgttc
ggcaaggtgatcctggtcaaggagaaagccacggggatgcactacgccatgaaaatcctg
cgcaaggaggtcatcattgctaaggatgaggtggcccacacggtgacagagagcagagtt
ctgcagaacacccggcatcctttcctcacaacactgaaatatgctttccagacccatgac
cggttatgttttgtgatggaatatgccaacggtggagagctcttctttcatctgtctcgg
gatcgtgtgtttacagaagatcgggctcgtttttatggcgctgagatcgtatctgcgttg
gagtacctccactctcgtgatgtggtttatagggacttaaagctggagaatctcatgctg
gacaatgacggacatatcaaaatcactgacttcgggctgtgtaaggagggcattacggac
ggagccacgatgaagactttctgcgggaccccggagtacctggccccagaggtgctggag
gacaacgactacggccgggcagtggactggtggggtctgggcgtggtcatgtatgagatg
atgtgtggccggttgcccttctacaaccaggaccacgagcggctgttcgagctcatcctc
atggaggagatccgcttcccccgaaacctggcccccgagggcaaggcgctgctcgccggt
ctgctcaaaaaggaccccaaacagaggttagggggaggaccggatgacgcaaaagacgtg
atgtcccacaagttcttcagctccatcaactggcaggacgttgtcgataggaagctgacc
ccgcccttcaagccccaggtgacatcagagacggacacccgctacttcgacgacgagttc
acggcacagaccatcacggtcacgcctccggacaagtatgataacctggactgcgaggac
cccaaccagccagcacacttccctcaattctcttactccgccagcattcgagaatga

DBGET integrated database retrieval system