KEGG   Esox lucius (northern pike): 105015898Help
Entry
105015898         CDS       T04894                                 

Definition
(RefSeq) neutral alpha-glucosidase C isoform X1
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
els  Esox lucius (northern pike)
Pathway
els00052  Galactose metabolism
els00500  Starch and sucrose metabolism
els01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:els00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    105015898
   00500 Starch and sucrose metabolism
    105015898
Enzymes [BR:els01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     105015898
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 DUF5110
Motif
Other DBs
NCBI-GeneID: 105015898
NCBI-ProteinID: XP_019909721
LinkDB All DBs
AA seq 581 aa AA seqDB search
MKRRRVPPQTDLRWLSESGLIDCMVLLGPSPSQVMSQYAQLTGYQALPPLFSLGYHQCRW
NYEDEADVKAVDAGFDHHNIPYDVIWLDIEHTDGKRYFTWDPVCFPDPVSLQRHLEDRKR
KLVVINDPHIKVDPDWSLYCEARDGGHFVKDREGQIYQGSCWPGDSNYLDFSSPATRAWY
SQRFALERYSTMPKDAMHHGGWEHRELHNLYGFHQHMATVQGLITRSGGLERPFALSRSF
FAGSQRLGAVWTGDNVASWDYLKISIPMILSLSLAGISFCGADVGGFVKDPDPELLVRWY
QAGALTPFFRGHAAMNTKRREPWLFGDQVTSAIRCVIQQRYLLLPYWYTLFHRAHTAGLP
PLRPLWVEFPADQDTFTVDHQYMIGGALMACPVTEPGATEVKVLLPGSEVWYDIQSTKLF
RGNRGLLPLPVTLDTVPVFQRGGTVVSRRTGCGSCTADLQKHPLSLTVALDSQGGAEGEL
YLDDGHSFRYRDRREFILRRFSLRSDRLICRCANPEGRYQSDDVVQSVTILGTRKRPANA
TLQQPGYQDVPVKFLFDEARHMLTLEDLNVGLGKDWDIKIL
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgaagaggcgtagggttcccccccagacagacctccgctggctatcagagagtggcctg
atcgactgcatggtgctcctggggccctctccatcacaggtcatgtctcagtatgctcaa
ctaacaggctaccaggccctgccacctctgttctcccttggttaccaccagtgtcggtgg
aactatgaagatgaggcggatgtcaaggctgtggatgccggatttgaccaccacaacatc
ccctatgatgttatctggctggacatagagcacacagacgggaagcgttacttcacctgg
gaccctgtctgcttccccgacccagttagcctgcagcgccacctggaggacaggaagcgg
aagttggtggtaatcaatgacccacacatcaaggtggaccctgattggtctctgtactgc
gaggctagagacggaggccattttgttaaggacagagagggacagatctatcaaggctcc
tgctggccaggtgattctaattaccttgacttcagcagcccagccacgcgggcctggtac
tcacaacgtttcgccctggagaggtactcaacaatgccaaaagacgcaatgcatcatggg
ggctgggagcacagggaactacacaacctatatggctttcatcagcacatggccacagtg
cagggtctgataaccaggtccggtggcctggagaggccgtttgccctgtcacgatccttc
ttcgctggctctcagagactaggtgctgtatggacaggggataatgtagcctcctgggac
tacctgaagatctccattcccatgattctctccctgagcctggctgggatctccttctgt
ggagctgatgtaggtgggtttgtaaaggacccggaccctgagctgttggtacggtggtac
caggccggcgcgctaactcctttcttcaggggccacgctgccatgaacaccaagcgaagg
gaaccgtggctatttggggaccaggtcacctctgcaatccgctgtgtgatccagcagagg
tacctcctgctgccttactggtacaccctgttccaccgggcccacaccgccggcctgccg
cctctcaggccgctttgggtggagttccccgcagatcaggatacctttactgtggaccat
cagtacatgatcggtggggcattgatggcttgtccagtcactgaaccaggagcaaccgag
gtcaaggtattactgcctggatctgaagtgtggtacgacatccagtcaaccaagctgttc
agagggaacaggggccttctgccactgcctgtaacactggacacagttccagtgttccag
cgtgggggtactgtagtgtctaggaggacggggtgtggctcttgtactgcggacctccag
aagcaccccctctccctgaccgtggctctggactctcagggtggtgctgagggagagctg
tacctggatgacggacactcttttcgctacagagacagaagagagttcatcctgaggaga
ttcagcttgcgttctgaccgcctcatctgtcgctgtgccaacccggaggggcgctaccag
tccgatgacgtggtccagtctgttaccatcctgggaaccaggaagagaccagccaacgcc
accctgcagcaacctggatatcaagacgtccctgtgaagttcctgtttgacgaggctcgg
cacatgctgacattggaagatctgaacgttggactggggaaagactgggatattaagatc
ctgtag

DBGET integrated database retrieval system