KEGG   Esox lucius (northern pike): 105016040
Entry
105016040         CDS       T04894                                 

Gene name
kif7
Definition
(RefSeq) kinesin-like protein KIF7 isoform X1
  KO
K18806  kinesin family member 7
Organism
els  Esox lucius (northern pike)
Pathway
els04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    105016040 (kif7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:els04812]
    105016040 (kif7)
Cytoskeleton proteins [BR:els04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     105016040 (kif7)
SSDB
Motif
Pfam: Kinesin Microtub_bd
Other DBs
NCBI-GeneID: 105016040
NCBI-ProteinID: XP_010877905
UniProt: A0A3P8Y340
LinkDB
AA seq 1354 aa
MSPKVPGQARAEETAVQVAVRVRPLLPKELLHSHDSCITADPEQLRVTLGHDRHFYCDFL
FEETGCQEEVYTVCVQPLIEAFFQGFNATVFAYGQTGSGKTYTIGEANISSFRDEEQGVI
PRAVAEVFKLLDENDLSDFSVRVSYLEVYKEDFRDLLEVETSSKDIHIREDDKGNIVLCG
VKECEVEGLDEVLSLLESGNTARHTGATQMNPHSSRSHTIFSVHMDQRRGGSRAHGATAT
GLQVLSSKFHFVDLAGSERILRTGNTGERLKESIQINSGLLALGNVIGALGDPKRRGTHI
PYRDSKITRILKDSLGGNAKTLMIACISPSSADFDESLNTLNYAKRARNIQNRATVNCRG
EPDRVEGLEQQIRALRRALENRQRSETRIIARSDPDRRPRPGEGEFNRLQAQSAHYRTCT
DTAYRLLRELQGEGALTAEQSLRVKEWLCSVEEERSGLTTASGPDSGIESSSAEDSAALR
RGRATVKNQEAELGGEKWSGEKEECVAQLQSQIQQLERENTDFLAALEDAMEQYKQQSDK
LQEQQDMITELQCMLSGPGVLGRGFHLTPRPHTAPLGSTRHTHNGLPSRQVGPVDCAESR
SFGDPIQYGDAYGQAHDQEDPGGGEAKGTEEEDTYMSHDRRRPWHQTSTKRDVVVGSTVG
GRVLLGQLPASGHLSTRRPSNSSVGDSSVGLGSEWSLQQAQQKIRELSVTIRMKEELIRE
LVKTGKDAQALNRQYSRKISALEGEAEQARQEVQEAQKQLQDLEKQEKETSGATDRTRAQ
ECRRKIAAAQSKVQVLSQRQRDTARLASLSAQSERRVSELERSVQNMRQQQDQLQRRLRQ
ESQQKRRLETEMQRRTHRVKELEKKNEQQQKILRIKTEEIAAFQKQRRSGSNGSVISLEE
QQKIEEQKRWLDEEMESVLEQRRGLEDLEGELTKREQILAKKEALLQERSGLETKRLRSS
QALSKDLVTLSGRIESLERELSERNGMLRSSSAQDSQQIRQEINNLRQEKDTLLKQRVEL
DDKLRQGSLLSPEEERTLFQLDEAIEALDAAIEYKNEAITQRQRQLRASASMLSQWEMNL
MAKLSYLSASETRALLCKYFDKVVSLREEERKLQLALADLEMRGEEQQKLVQWLENALER
TQLDTDRRLTQQQKEHERNVQLLLQQCREQIDEGLAGRQRQYEGWIHNLNKELSHLKTVN
LELSNRLRELCGRTSQPLEQGKVSVFECRTAGIGSVERLNRGQDDNQSGRGGPGEPERPP
RSREEMRELVHAPLPATWRRSSLPNEDPCGMEELQQQMAVEMPVNRVIQTSTGPWGGTPS
LSIAKSRRDSRRSSLNTGPLSSNTSIIDVRKNPF
NT seq 4065 nt   +upstreamnt  +downstreamnt
atgtctcccaaagttccaggccaggccagggcagaggagacagcggtgcaggttgctgtt
cgagtgcgccccctgctgcccaaggagctgctgcacagccacgatagctgcatcaccgct
gaccctgagcagctcagggtcactttgggccatgaccgacacttctactgtgacttcctg
tttgaggagaccggatgtcaggaggaggtgtacactgtgtgtgtccagcccctcatagag
gccttctttcagggcttcaacgccactgtcttcgcctacggacagacaggctctgggaag
acatacactatcggcgaggccaacatttcttcctttagggatgaggagcagggtgtcatc
cccagggctgtggctgaggtgttcaaactgctggatgagaatgaccttagtgacttctcc
gtccgagtgtcttacctggaggtgtacaaggaggacttcagagacctactggaggtggag
acatccagcaaggatatccacatcagggaggatgacaagggcaacattgtactgtgtggg
gtgaaggagtgtgaggtggagggtctggatgaggtactgagcctgctggagtcaggcaac
acggcccgacacacgggcgcaacccagatgaaccctcactctagccgctcacacaccatt
tttagtgtgcacatggaccagcgccgcggtggctcccgggcccatggtgccacagccacc
gggcttcaagtcctctcgtctaagtttcactttgtggacctggcggggtcggagagaatc
ctccgtacagggaatactggagagaggctgaaagagagcatccagattaacagtggcctt
ctggctctggggaatgtcataggggccctgggggaccccaagaggagaggcacccatata
ccatacagggactccaaaatcaccaggatattgaaagactccctgggaggaaatgccaaa
acactgatgattgcctgcatcagcccctcgtcggcagactttgatgagagcctaaataca
ctaaactatgccaagcgggctcgcaacatccagaaccgggccaccgtaaactgccgtgga
gagccggaccgtgtggaggggctggagcagcagattcgggctcttcgcagggcccttgag
aaccggcaacgctctgagacccgtatcattgcccgttctgacccagacaggcggccacgc
cccggagaaggagagttcaatagattgcaggctcagagtgcacactacaggacctgcact
gacactgcgtacaggttgttgcgtgagctgcagggtgagggggcgttgactgctgagcag
agcctccgggtgaaggagtggctgtgttctgtggaggaggagcggagcggcttgaccacc
gcttctggacctgacagcggcatcgagagcagctccgccgaggactccgcagcgctgagg
agggggagggctactgtcaagaaccaggaggcagagcttggtggggagaagtggagtggt
gagaaagaggagtgtgtggcccagctccagtcccagatccagcagctggagagggagaac
acagacttcctggctgctctggaggatgccatggagcagtacaaacagcagagtgataag
ctgcaggaacagcaggacatgataactgagctgcagtgcatgttatctgggccaggtgta
ctgggacggggcttccacctgaccccgcgcccccacactgccccgctcggctccacgcga
cacacccacaacggactccccagcagacaggtaggcccggtggactgtgcggagagcagg
tcgttcggtgacccgatccagtatggcgatgcttatggccaggctcacgaccaggaggac
ccaggagggggggaggcgaaaggcacagaggaggaggacacttacatgagccatgacaga
cgacgaccgtggcatcagacctctaccaaaagggacgtcgtggttggatccacagtggga
gggagagtccttctgggtcaactgcctgcctctggacacctctccaccaggcgaccatcc
aactccagtgtcggggacagctcagtgggcctgggctcagagtggagcctgcagcaggcc
cagcagaagatcagagagctgtctgtcaccatccgcatgaaggaagagctcatcagagaa
ctagtcaagacgggtaaggacgcgcaggctctgaacaggcagtacagccgtaagatctct
gccctggagggggaagctgagcaggccaggcaggaggtccaggaggcccagaaacagctt
caggacctggagaaacaggagaaggaaacaagcggtgcgacagatagaaccagggcccag
gagtgtcgacggaagatcgctgcagcacagagcaaagtacaggtcctgagccagcgtcag
agggacacggcacggctggcgtcgctgtcagcgcagagcgagcgccgcgtgtcagagctg
gagcgtagcgtgcagaacatgaggcagcagcaggaccagctgcagagacgtctgagacag
gagagccagcagaaaagacgcctggagacggagatgcagcggcgaacacacagggtcaag
gagctggagaaaaagaatgagcagcagcagaagatcctgaggataaagactgaggagatt
gctgcctttcagaaacagagacgcagtggcagcaacggctctgtcatctcactagaggag
cagcagaagatagaggagcagaagcgttggctggatgaagagatggagagtgttctggag
cagaggagaggactggaagacctggagggggaactaaccaagcgtgaacagatcctggcc
aagaaggaggccctgctacaggagcgcagtggtctggagaccaaaagactccgctccagt
caggcactcagtaaggacctggtgacgctgtcgggtcgcattgagtccctggaacgggag
ctgagtgagaggaacggcatgctccgcagcagcagcgcccaggactcccagcagatccgc
caggagatcaacaacctgcgccaggagaaggacacgctgctcaaacagagggtggagctg
gacgacaagttacggcagggcagcctgctctctccagaggaggagcggaccctcttccag
ctggacgaggccatcgaggctttggatgcggctatagagtataagaacgaggccatcaca
cagagacagcgacagctcagggcctcggctagcatgctctcccagtgggagatgaacctc
atggccaaactcagctacctgtctgcatcagagacccgtgcgctgctctgcaagtacttc
gacaaggtggtttcactgcgtgaggaggagcgtaagctacagttggccctggcagatctg
gagatgcggggtgaggaacagcagaagctggtgcagtggctggagaacgctctagagcgc
acacagctggacactgaccgtagactcacacagcagcagaaggagcacgagaggaatgta
cagctactactgcaacagtgccgagagcaaatagacgagggcctggcggggaggcagagg
cagtatgaaggctggatccataacctcaacaaagagctgagccacttgaagaccgtcaac
ctggaactgagcaacaggcttagggagctgtgtggccgcaccagccaacccttggagcaa
ggtaaagtttcagtctttgagtgcagaacagcaggtattggtagtgtggagaggctcaac
cgaggccaagatgataaccaaagtgggagaggagggccaggggagcctgagagacccccc
agatcaagagaggagatgagggagctggtccacgcccctcttccagccacgtggaggcga
tcctccctccccaacgaggacccttgtggcatggaggagctacagcagcagatggctgta
gaaatgccagtaaaccgggtgattcaaacaagcactggaccttggggcgggacaccctca
ctttctattgccaaatcacgcagagattcccgtcgatcaagtcttaacaccgggccactg
tcctcaaacacttctataattgatgtgcggaagaatcctttttaa

DBGET integrated database retrieval system