KEGG   Esox lucius (northern pike): 105016554
Entry
105016554         CDS       T04894                                 

Gene name
gpr161
Definition
(RefSeq) G-protein coupled receptor 161
  KO
K08439  G protein-coupled receptor 161
Organism
els  Esox lucius (northern pike)
Pathway
els04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    105016554 (gpr161)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:els04030]
    105016554 (gpr161)
G protein-coupled receptors [BR:els04030]
 Rhodopsin family
  Others
   Orphan GPCRs / unclassified GPCRs
    105016554 (gpr161)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7tm_4 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 105016554
NCBI-ProteinID: XP_028969266
LinkDB
AA seq 537 aa
MNGSASWNVSTGGNATEAWYEDEGPAVLESVFIVAIALLAFLGNFLIVATLYCRPYLLTP
SNKFVFSLTLSNLLLSILVLPFVAVSSARREWVFGVVWCNFTALLYLLISSASMLTLGAI
AIDRYYAVLYPMIYPMKITGNRAVLAIAYVWLHSLVGSLPPLFGWSSFEFDRFKWTCVAS
WHRNPAYTAFWVAWCALPPLVAMLACYGVIFRVARHKARKVHCGTTVVASSDDASSGSQT
NGQRKNSSTSTSSTGSRRSLVYAGSQCKALVTIMVVIGTFVVTWGPYVAVVCAEALWGQS
SVAPRLETLVAWLSFCSAACHPLIYGLWNKTVRKELLGMCLGDRYYRVESFGTRHRTSRL
FSISNRITDLGMSPHLTAMLVGGGQLLAPGSSTGDTGFSFTQDSCTDVMLLDNFSTDGSS
HQGSVAVKRRSSVTFEDEQQHSKESPPTPPPAQVQVEIHKALDTFASCLARAIENDAKLT
LFGEGAPISGTLFAAARGPPRPRYLDGQRLRLESIDEGIVRDDTEDQEGDDEEELSA
NT seq 1614 nt   +upstreamnt  +downstreamnt
atgaacggcagcgccagctggaatgtctccactgggggaaacgccacggaggcgtggtac
gaggatgagggcccggcggtgctggagtcagtgttcattgtcgccatagccctcctcgcc
ttcctcggcaacttcctcatcgtggccaccctgtactgccggccctacctcctcacgccc
agcaacaagtttgtgttcagcctgaccctgtccaacctgctgctgtccattctggttctg
ccgttcgtggcggtgagctcggcgcggcgggagtgggtgttcggagtggtctggtgcaac
ttcaccgccctactgtacctgctcatcagctcggccagcatgctcaccctgggggccatc
gccatcgacaggtactatgctgtgttataccccatgatctacccgatgaagatcacgggt
aaccgggcggtgctggccatcgcctacgtgtggctccactccctggttggctccctgccg
ccgctcttcggctggtcgtccttcgagtttgaccgcttcaagtggacctgcgtggcgtcc
tggcaccgcaaccccgcctacacagccttctgggtcgcctggtgtgccctcccgccgctg
gtcgccatgctcgcctgctacggcgtcatcttccgcgtggcgcgccacaaggcccgcaag
gtgcactgcggcaccaccgtggtggcctcgtcggacgacgcctcttcgggctcgcagacg
aacggccagcgcaagaactcgtccacgtccacgtcgtccaccggcagccggcggagtttg
gtgtacgccgggagccagtgcaaggccctggtgaccatcatggtggtgatcggcacgttc
gtggtgacatggggcccgtacgtggcagtggtgtgtgcggaggccctgtggggccagagc
agcgtggccccgcgtctggagaccctggtggcgtggctgtccttctgcagcgccgcctgc
cacccactcatctacggcctctggaacaagaccgtgcgcaaggagctgcttggcatgtgc
ctcggcgaccgctactaccgcgtggagtcgttcggtacgcgtcaccgcacgtcccgcctc
ttcagcatctccaaccgcatcacagacctgggtatgtcccctcatctgacggccatgctg
gtgggaggagggcagctgttggcccctggtagcagcaccggagacacaggcttcagcttc
acccaggactcatgcacagacgtgatgctgttggacaacttctccacagatggctcctcc
caccagggaagtgtggcggtgaagaggaggagctcggtcacctttgaagatgaacagcag
cattccaaagagagcccccccacgcccccgccggcccaggttcaggtagagatccacaag
gctctggacactttcgcctcctgcctggccagggccatcgagaacgacgccaagctcacg
ctgttcggcgagggcgcccccatatccgggacgctgttcgcggcagcaagggggccaccg
agaccccgatacctggatggccagcgactgagactggagagcatcgacgaagggatcgtc
agagacgacaccgaggaccaagagggggacgatgaggaggagttgtctgcatga

DBGET integrated database retrieval system