KEGG   Esox lucius (northern pike): 105016652Help
Entry
105016652         CDS       T04894                                 

Definition
(RefSeq) MARVEL domain-containing protein 3
  KO
K21099  MARVEL domain-containing protein 3
Organism
els  Esox lucius (northern pike)
Pathway
els04530  Tight junction
Brite
KEGG Orthology (KO) [BR:els00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    105016652
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:els02000]
    105016652
Transporters [BR:els02000]
 Other transporters
  Pores ion channels [TC:1]
   105016652
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MARVEL MASE1
Motif
Other DBs
NCBI-GeneID: 105016652
NCBI-ProteinID: XP_010878938
UniProt: A0A3P9A3N1
LinkDB All DBs
AA seq 326 aa AA seqDB search
MSKNRYLDKDEYSERGRSQDKGGSEKREWERARDGRRDKRDERYRDEKGSANDRRGRGKE
FSDRHQDLRPHSHKDRPPDHRPSNKEGQQRTYTEPSVSPSEVEYYEPPHRQSLYNLRYTL
TTRGLCQIMEVFVNLLIVICSGVNYSNTGVYRDLASLGGIYQYYFGGAQAFTGAEADRVK
ELDQLFNQLKLPPYIFSMACGGALMAYACVMLALGVLRIPYRWPPMLLAETLMNLVVGLG
YIPALAFYFIKLQETYDSPVCKEREALYKSKGHQGFECSMNGADIAGGLFGALGVIVFMF
GTVLAIRAFRAVRETKRQRAMEDDNL
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaagaacagatacctggacaaggacgagtatagtgagaggggccgttctcaagac
aaaggaggatctgaaaagagagaatgggaaagagcaagagatgggaggagagacaaaagg
gatgagagatacagggatgagaagggctctgccaatgacaggaggggcagagggaaggag
ttctcggacagacatcaggatttgagaccccactctcacaaggaccggccgcctgaccac
agacccagtaataaagaaggacagcagagaacgtacacagaaccctcagtttctccctcc
gaagtggaatactatgagccaccacacagacagtctctttacaacctcagatacacctta
accaccagaggtctgtgccagataatggaggtctttgtaaacctgttgatagttatctgc
tcaggggtgaactacagtaacactggagtttaccgggacctggccagtctcggaggcata
taccaatactactttggaggagctcaggctttcactggagccgaagcagaccgtgtgaag
gagctggaccagctgtttaaccagttgaagctgcccccatacatcttcagcatggcctgt
ggaggggctctgatggcctatgcctgcgtgatgctggctttgggtgtcctaagaatccct
tatcgatggccccctatgctgctggctgagacactgatgaacctcgtcgttggtctgggc
tatatccctgccctggccttttacttcatcaagctgcaggagacgtacgacagccccgtt
tgcaaggagagggaagcgctctacaaaagcaaaggtcatcagggctttgagtgttcaatg
aatggagcagacatcgccggaggcctcttcggggcgcttggggtcattgtcttcatgttc
ggtacagttttggctatccgtgcttttagggcagtgcgagagactaagagacagagagca
atggaagatgataacttataa

DBGET integrated database retrieval system