KEGG   Esox lucius (northern pike): 105016687Help
Entry
105016687         CDS       T04894                                 

Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase E
  KO
K05622  transglutaminase 5 [EC:2.3.2.13]
Organism
els  Esox lucius (northern pike)
Brite
KEGG Orthology (KO) [BR:els00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    105016687
Enzymes [BR:els01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     105016687
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_N Transglut_C Transglut_core
Motif
Other DBs
NCBI-GeneID: 105016687
NCBI-ProteinID: XP_010879001
LinkDB All DBs
AA seq 703 aa AA seqDB search
MSLDVVKVDLNCEKNNRAHNTIDISASRLIVRRGQSFLVRLELRGPFRPTTDVLELTVET
GPKPSERLGTRSVFRLSASLGNDSSWMAEVHRDSNLPAGSVTLGITSPANAPVGEYRLSL
SVKTSTTAVTGRSLCKLILLFNPWCQEDWVYLPKQEERQEYVMTEHGLVFIGGSRSISSM
AWDFGQFEPDIVDICLKMLDMNPKCLRNPPEDFSARCNPIYVSRVVSAMVNTNDDKGVVA
GRWSEPYAGGERPTSWHGSVDILRRWYRSNCNPVKYGQCWVFASVVCTVLRCLGIPCRVI
TNFGSAHDTDKNLTIDKYYSDYGIYPDSNDSVWNFHVWVEAWMKRPDLSRDSLYDGWQVV
DATPQETSNGVFCCGPAPVKAILEGHTDLKYDVDFVFAEVNADQVEWKVFPDGSKTRINT
DTSSVGQNISTKAIGIDRRQDITANYKYAEGTEMERIVYNQAVRRGTKPRYSDDTVDNHL
QNRLDVSPSIVLLNKPVYGQDIDLKLTLKNDDRVTRTLLIRVNAQAVRINGTISSQIQSQ
LIEQMILPNQDLAFPILIPFSVYGEKMLESNSVKVSAVVSDKGNPELVRITEQDIVPDTP
PFSITANGSAVLYGGEMTAETMFENPLSEYLTDCCITVTGSGLLKQPIESRIPMLKPRQR
IRLTWAFTPSRPGLKKLVATFDCGQFRNIKASCNVEVRPAPGA
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgagtttggatgttgttaaagttgacctgaactgtgagaagaacaaccgcgcccacaac
accattgacatctcagcgtccagactcattgtcaggaggggtcagtccttcctggtccga
ttagaactccgtggtcccttcaggcccactaccgatgtcctggagctgacggtggagaca
gggcccaaaccgtcggagcggctggggacccggtcggtgttcaggctctctgccagcctt
gggaacgattcgtcctggatggcagaggttcacagggattcaaatctcccggcaggttca
gtcacccttggcatcaccagcccagcaaatgccccagtgggagaatacagactcagcctg
tcggtaaaaaccagcaccactgccgtaacgggccgtagcctatgcaaactgattctgctg
ttcaacccctggtgccaagaggactgggtgtacctacctaaacaggaggaaaggcaggaa
tatgtgatgacagaacacggcctggtgttcattggaggttccagatccatcagctctatg
gcgtgggactttggacagtttgaacctgacattgtggacatttgcctgaagatgcttgat
atgaacccgaagtgtctgagaaaccctcctgaggacttctctgctcgctgcaaccccatc
tacgtcagtagggtggtcagtgccatggtcaacactaacgacgataaaggtgtcgttgcg
gggcgatggagtgagccctatgcagggggagagagacccactagctggcatggcagtgtg
gacatactgagaaggtggtatcggtccaactgtaatccagtcaagtatggccagtgttgg
gtgttcgcctctgtagtgtgcacagtactgaggtgtctgggaatcccgtgtcgagtgatt
actaactttgggtcagcccacgacaccgacaagaacctgacaattgataaatactactcc
gattatggaatctacccagactcaaacgactcagtctggaacttccatgtgtgggtggag
gcctggatgaagcggcccgatctctcacgcgactccctgtacgacggctggcaggttgtg
gacgccaccccccaggagacaagcaatggtgtgttctgctgtggtccagctccggtcaaa
gccatattggagggtcacactgacctcaaatacgatgtggactttgtcttcgccgaagtc
aatgctgaccaagtcgaatggaaggtgtttcctgacggctccaagacaaggataaacaca
gacacttcctctgtgggccagaacatcagcaccaaggccatcggcattgacaggagacag
gacatcacagccaattacaaatatgcagagggcacagaaatggagagaatcgtgtacaat
caggccgtgagaagaggcaccaaacccagatacagtgacgatacagttgacaaccatctc
cagaatcgtttggatgtatccccaagtattgtgttgcttaacaagccagtctacgggcaa
gacattgacctcaagcttacattgaaaaacgatgaccgtgtgactcgaaccctactgatt
cgtgtcaacgctcaggccgtgagaatcaatggcaccatatcatcccagatacagagtcag
ctaattgaacagatgatccttcccaaccaagatctggccttccccattctcattcccttc
tctgtgtatggtgagaaaatgctggagagtaacagtgtgaaggtctcagcggtggtcagt
gacaaaggcaacccggagttggtgcgcatcacagagcaggacattgtcccagacactcct
ccattctcaatcacagccaatggatctgcagtgctgtatggtggtgaaatgacagcagag
actatgtttgagaaccctctgtctgagtatttaacagactgttgcatcacagtgacaggg
agtggcttgctgaagcagccaatagaatccagaattcccatgctaaaaccaagacagcgg
attcgtttgacatgggccttcactccaagcagacccggcctcaagaagcttgtggccacc
ttcgactgcggccaattcaggaacatcaaggcaagctgcaatgtggaagtcagacctgcc
ccaggtgcctga

DBGET integrated database retrieval system