KEGG   Esox lucius (northern pike): 105016738Help
Entry
105016738         CDS       T04894                                 

Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase 2
  KO
K05625  transglutaminase 2 [EC:2.3.2.13]
Organism
els  Esox lucius (northern pike)
Brite
Enzymes [BR:els01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     105016738
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 105016738
NCBI-ProteinID: XP_010879060
LinkDB All DBs
AA seq 678 aa AA seqDB search
MTEALDIASWDLECEFNNTDHRTELNGTERLIVRRGQPFTVNLHLRSGAYQPGSSALDLT
AETGPQPSDQYGTRASFGLTDQINTSQWSAAVTSHMDMVSLSICSPPDAPIGRWRLSLGQ
AGQFEFVLLYNPWCTGDMVYMEGEKELEEYVLAQDGIIFRGNSQYPIPTPWNFGQFEDGI
LDACLRILDMNPKCLRNPGKDASGRRNPIYVSRVISAMVNCNDDQGVLLGKWTNDYTDGV
SPMSWRGSVEILRNWDRTACEPVRYGQCWVFAAVACSVSRALGIPSRVITNYQSAHDSNS
NLIIELFVDENGQLMKNSRDMIWNYHCWIENWMTRPDLQTGFDGWQAVDPTPQEKSEGVY
CCGPIPLKAIKQGEITYKYDGPFIFAEVNADVHTFWKLKDGRTKKVITTTKVGLKISTKS
VGSDEREDITHLYKYPEGSEEERETFTKANHQNKLLQQQDNAGLLINVKVSPEMRKGCDF
DVFAVVTNNTGSEKKCRLVFGSRAVSYNGILGGNCGFKDLLNVQLAPGQEKRIALRMNFS
NYASHLTEDNLIRLAALLVDYSTQEAYLAVRNIVLVNPEIRVRILGEPKERRKLAAEITL
QNPLSVPLLDCCFTVEGSNLTDGKIITERLDSAVEPGQDAKVKIYFTPTRSGLRKLVVDF
DSNKLCHVKGYRNVIIGK
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagcactagacattgcctcctgggatctggagtgtgagttcaacaatacagac
caccgaacggagctcaacgggacagagcgcttaattgtgagacgaggccagccgttcacc
gtcaacctacacctccgctctggcgcctatcagcccggcagcagtgctctggacctcacc
gcggagacaggtccccagccctctgaccaatatggcacgcgggcctcctttggtctgacc
gaccaaatcaacacatcccaatggagcgccgccgtcaccagtcacatggacatggtgtcc
ctgtccatatgttcccccccggatgctcccatcggacgctggcgcctcagcctgggtcag
gcgggccagtttgagtttgtgctgctctataacccctggtgcacaggcgacatggtgtac
atggagggggagaaggaattggaggagtatgtcttggctcaagacggcatcatctttcgg
gggaacagtcagtaccccatccctacaccttggaactttggccagtttgaggatgggatc
cttgacgcctgtctgagaatcctggacatgaacccgaagtgcctgcgtaaccctgggaag
gacgcttccggccggaggaacccgatctacgtgtccagagtcatcagtgccatggtgaac
tgcaacgacgaccagggagtcttgctaggcaagtggactaatgactatactgatggcgtg
agccccatgtcctggaggggcagtgtggagatcctgcggaactgggacaggactgcctgc
gagcctgtgcgctacggccagtgttgggtgtttgctgcggtggcctgttcagtgtctcga
gccctgggcattccttctcgggtgatcaccaactaccagtcggcccacgacagcaacagt
aatctgatcatagagctcttcgtcgatgagaacggacaacttatgaaaaattccagagac
atgatatggaactaccactgttggattgagaactggatgaccagacctgatctccagaca
ggttttgacggctggcaggctgtggatcccactccacaagagaagagtgaaggagtttat
tgctgtggccctattccactgaaagccatcaagcagggcgagatcacctataaatatgac
gggccgtttatattcgccgaggtcaacgccgatgtgcacaccttttggaagctcaaagac
ggacgcacaaagaaggtcatcaccaccactaaagtgggcctgaagatcagcaccaagagt
gttggcagtgatgaaagagaagacatcacacacttgtacaaataccctgagggttctgaa
gaggaacgagagacatttactaaagcaaaccaccagaacaaacttcttcagcagcaagat
aatgctggcctgctcatcaacgtaaaggtttctcctgagatgaggaagggatgtgacttt
gatgtgttcgccgtggttacaaacaacacgggtagtgagaagaagtgccgtctggtgttt
ggctccagagccgtgtcctacaatggcattctgggaggaaactgtgggttcaaagacctg
ctcaatgtacagttagcacctggacaagaaaagcggatagctctgaggatgaacttctcc
aactatgcaagtcacctaactgaggacaacctgatccggctggcggcccttcttgtagac
tacagtacccaagaggcctacctcgctgtcaggaacatcgtactggtgaaccctgagatc
agagtcaggatccttggggaacccaaggagcgccgtaaactggcagctgagattacccta
cagaacccactctcggtaccactgctggactgctgcttcaccgtggaaggatccaatctc
actgacggcaaaatcatcactgagagactcgattcggcggtggaacccgggcaggacgcc
aaggtcaaaatctacttcacgcccacccgctcaggtctgaggaaactggtggttgacttt
gacagcaacaagctgtgtcacgtcaagggctacaggaacgtcattatcgggaaatag

DBGET integrated database retrieval system