KEGG   Esox lucius (northern pike): 105016756
Entry
105016756         CDS       T04894                                 

Gene name
evc
Definition
(RefSeq) ellis-van Creveld syndrome protein isoform X1
  KO
K19605  ellis van creveld syndrome protein 1
Organism
els  Esox lucius (northern pike)
Pathway
els04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    105016756 (evc)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:els03036]
    105016756 (evc)
Chromosome and associated proteins [BR:els03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other cilium assembly proteins
    105016756 (evc)
SSDB
Other DBs
NCBI-GeneID: 105016756
NCBI-ProteinID: XP_010879089
UniProt: A0A3P8ZW50
LinkDB
AA seq 969 aa
MNDQEIITECSNDVFVHFAESLHIFTGLLTVSTVCGGFSGIIAAALLYVFCLKPMLLSRK
GYDARRLFEVDDLERENHPSDCVSNSKKGVQSDHVNNSKKGVQSATANEKEKKQPPMNSD
VAAFASRAKVVYPINQKYRPLADGASNPSLHEHSKLPVLTNGESLSGSSRESLSQDQDND
DSSQFISSSLVPKSLQNESFTRVANYPNTIYQAGFEGRISLYCLALQDVQQHCSQAQEEK
CLLFLKILRILLGNRFPKDKMESAFYNNILHLQETDLDSLKRDLSAGLFACQRNKDPGED
CTLEEIERTQKDLLEHGLQMTKGFSKQVESFCQSLLGRSSVLPRDEAQEVIRTAIYCLLL
VENHLTETQAADMKRIQERLLWWEELRGLLQAKPALLRREASLRHSLVARGLEQLTSDGH
LTFATMETTLMELQAALTEGLQNCSEECRMKTKELVYERCKKIDSKKKKLLSAHRKERSC
ALDSAQAHSDPQEFVKVYQELLLRQRKQNTDLELQQDGKVTEMVCDLWRRHYATWSKRLG
DLTKDIFLPALPGQSQLSTDQCKRLWLDLEGELVGLQQQAEGQTRRQLEGLRAQLKQDGQ
VWSEEMALILSCLRHLSDQQLKILRGMVVRQSYMLNSHVGMLIEKKQHLLLAAIQRHFVA
RHFCLRVLKEMRLSKLKVMSQGADSKAMLALDDHNQGQAPVSSALPKDPHQDSSSSVAER
HLGPETQLIGHSFQQEFLSELETASELLQANAQLLVGHALSHSLRQQMDLTTPTGPQPDH
SRKSQLTEVASESVYVTWDSLSTLVTSYYAQIQDITRSLQQQQRSNWAREEGERRESSTQ
MNKDLLKELANWERKPMSSEFHQRVELQKKRMLEQYDLEQEVACETLRRRKLAQEQTMEI
FKRQLQEAEEAFAAKLSSLARIPPSRKELITEDDTIGEEENPTLNPTLWKRRERRERETL
LTNPALLFS
NT seq 2910 nt   +upstreamnt  +downstreamnt
atgaacgaccaggaaattataacggaatgctctaatgatgtttttgttcacttcgccgag
tctctgcacatatttactggattgttaaccgtatccactgtatgcggggggttctctgga
atcatagctgcagccctcctgtatgtgttttgccttaagcctatgctactgtctcgaaaa
ggctatgacgccagaagactattcgaggtggacgacctggagagagaaaaccacccaagt
gattgtgtcagcaacagcaagaagggtgtccaaagtgaccatgtcaacaacagcaaaaag
ggtgtccaaagtgccacggccaatgaaaaagaaaagaagcaaccaccaatgaacagcgac
gtggctgcttttgcatcacgggcgaaagttgtgtaccctatcaaccagaaatacagaccc
ttagcagatggcgcctccaacccctcattgcacgagcactccaagctacctgtcctcact
aatggagagtccctgtcaggctccagcagggagtcgctgagccaggaccaggacaatgac
gacagtagccaattcatctcgtcctcactggtccccaaaagcctgcagaatgaaagcttc
acccgggtggccaactaccccaacacaatctatcaggctggttttgaaggcaggatcagt
ctgtactgtctggccctgcaggatgttcagcaacactgttcacaggcccaggaggagaaa
tgtttgctctttctcaaaatcctccgaattctacttggcaatcgttttcccaaggataaa
atggaatcagctttttacaacaatattcttcacctacaagaaacggacctggattcattg
aaaagagacttgtcagcaggtctgtttgcctgtcagagaaataaagatcctggagaagat
tgtactctggaggagattgaaagaactcagaaagacctattggagcatggccttcaaatg
acgaagggttttagcaagcaggtcgagagcttctgccagagtctcctgggcaggtccagt
gtgctacccagggatgaggcccaggaggtcatccgcaccgccatttactgtctcctcttg
gtggaaaaccacctgacagagacccaggctgcagacatgaagaggatccaggagaggctg
ctgtggtgggaggagctgagaggtctgctgcaggccaagccggccctgctgagacgggaa
gcgtccctcaggcactccctggtggcccgaggcctcgagcagctgaccagtgatgggcat
ctgacgtttgccaccatggagacaaccttgatggagctacaggccgccctgaccgagggc
ctccagaactgcagtgaagaatgcaggatgaagaccaaggaacttgtgtatgaaaggtgc
aagaagatcgattccaagaagaagaagctcctgagtgctcacaggaaggagagaagctgt
gccctggattctgcacaggcacacagcgacccacaggaatttgttaaggtgtatcaagag
ttgcttttgagacagaggaagcagaacactgacctggagctgcagcaggatgggaaagtg
acagagatggtgtgtgacctctggaggaggcattacgccacctggtccaagaggctcggt
gatctgaccaaagacatcttcctgcctgctctccctggccagtcccagttgtccacggac
cagtgcaagaggctgtggctggatctggaaggggagttggtcggactccagcagcaggca
gagggccaaaccagacggcaactggagggcctacgagcccagctgaagcaggatggacag
gtatggagtgaagaaatggccctgattctgtcctgcctccgccacctgagtgatcagcag
ctgaagatcctcagaggcatggtggtcagacagagctacatgctaaatagccacgtgggg
atgctgatcgagaagaaacagcacctcctgctggcagcaattcagaggcactttgtggca
agacacttctgtctgagggtgctgaaggagatgaggctgtcaaagctcaaggtgatgtct
caaggggccgactccaaggccatgttggctctggatgatcacaatcaaggccaagcccca
gtcagctcagcactgcctaaagacccccatcaggactccagttccagtgttgccgagagg
cacctgggcccagaaacgcagctgattggccacagcttccagcaggagttcctgtcggag
ctggaaacagcatccgagcttcttcaggccaacgcccagctgctggtggggcacgccctc
agccatagcctccggcagcagatggacctgaccacgcccaccggcccccagccggaccat
agcaggaagagccagctaacagaagtggcctcagagagtgtgtatgtgacctgggattcc
ctcagcaccctagtcaccagctactatgctcagatccaagacatcacaaggagtcttcaa
cagcagcagcgttctaactgggccagagaggagggtgaacgacgagagagcagcactcag
atgaacaaggatctgttaaaggagctagccaactgggaaagaaagcccatgtcttctgag
tttcatcagagggttgaactgcagaagaagaggatgttggaacaatatgacttggaacag
gaagtggcatgtgaaactctgaggaggaggaagctggcccaagaacaaaccatggagata
tttaaaagacagctacaggaggcagaagaggccttcgcagcaaaactgtcctccttagca
cggatcccaccatcccgcaaagagctaatcactgaggatgacaccataggggaggaggag
aatccgacactgaatccaacactgtggaagaggcgagagaggcgggagcgtgaaactctg
ctgaccaatccagcgcttttgttttcatag

KEGG   Esox lucius (northern pike): 105016757
Entry
105016757         CDS       T04894                                 

Gene name
evc2
Definition
(RefSeq) limbin
  KO
K19608  ellis van creveld syndrome protein 2
Organism
els  Esox lucius (northern pike)
Pathway
els04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    105016757 (evc2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:els03036]
    105016757 (evc2)
Chromosome and associated proteins [BR:els03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other cilium assembly proteins
    105016757 (evc2)
SSDB
Motif
Pfam: EVC2_like
Other DBs
NCBI-GeneID: 105016757
NCBI-ProteinID: XP_019911278
UniProt: A0A3P8Y2B6
LinkDB
AA seq 1400 aa
MIQVHIFVEGLITVCCVFLCFQLQYRPLFRIQQRSIYLYGFHNFSHSQNTCQSAFRGDSN
NIHSALCNALLSWGTPQNQYESGKPRYWPGPIRHNPGVKSAEPIVKMNGQQGPCGPSAFC
VERGPLHSGAPTPGPWGQPFYASVSHLVNMVQRGARRRRSSLIRHITGHALPQTESAAQP
AGFGLKFNKCAQVGEGTEFPHLTFFLLIHNIGPPGGTNLSQLAIRDSVSGIAPLQSGGTV
VEKGFQTFTIDSLPAGSRYTVTYTALIKGHKSVVLDLPAFLTFSNASLNDVSMFGPVVAN
LTLRLNSTDKIYPNHGVHFAGFVCGFFLSLLLLSLGFLAINLICARARKNSLQQRIKRGD
SDPEYAVCNMSETVKEEAAFEDKMVDIMVLEEPQNMYQALENLEMSSLLQATSSLESSRV
QMYKDVIAALLASLRSQNHMSQQAEQRLLSVLHGQLMGMEGKLKEEHVARMATLAAQCNL
ETREQMEAEHRREAQEKAQAEVLFRHADQQELLQVSVLLEKLHKLNQSQLQRSLLVKHEE
ASARVQRQIVEWRRVELHKIFSEELEEATRMGELEKNVARSLLHDYFTCQNQLEEVLDVV
LANQRCMLGERHAQRRFLVHSLYSLKGLISETFSKTSSQMENCFKEHGRGSDVSEEQREQ
QLDKVQKELVLVKQRLDEALNRERRAMHCGLVKKRRELLSDMLQGHKQRQRELSALSRGG
LEGERAEVDPAQHLLCWQSLLTTQCQELGELINNLDEEAAADIRKVTMRLIHSSMAEVKV
IQAASQALLALGPPQQPDAGATAGAGTSALSQAQERLHLEGKGAVRILQASRDSLRQGMM
REQRAQLEMRARARAFFRSLCSSQLTLSDEDLLRMMLEFQKCLSRMDHCLVVPHALSRSK
LQTALTSWRKEVLEEQTEPLQQPENKTRPRGKSTEDRQRAGPSELLLFRKKMEGRIQLFE
KEKEMENTIMEKVLEEMQGEREVELQSQVDGLAVQMAALHYQKAERRTRVLETSRALLTV
QSLITEELRASRSLASAPIAQSIQNHYLGLEEAEHQLQREHAELESLETGPSKPPEHKLP
KHSDASANEDEGEEEDGRLFRIERDSRMAAILHEALYKCDQVTSLQMERLQEANARSQAM
EDLKEQLELKRLYSNCDQDLEFAARLVRQSQISTEVLLEALRLLLPTLPESELLSLIDAL
CPKQPTLLGSTEQQNPSWPEGAGKSLLVRLRAEMIGRNVSAHSTILEQNQFQEKRPSLLE
RLFMNPRPEAPRDIMPVLVQEKGREGATLLTPQQLASKPVVTGTSRTPASEQLQDSVLIS
VGGASVNSETVFDSQRTTAASTFGSASGAVMVDIPTTGERVFVFRSPPDPLSTQGTTDCK
RKKRNFLNLKKGSVAPMDRP
NT seq 4203 nt   +upstreamnt  +downstreamnt
atgattcaggtacatatcttcgtggaagggctaatcacggtatgctgtgttttcctttgt
tttcaactacaatataggcctttatttcggatacaacagcgatctatttatttgtatggg
ttccataattttagccatagtcaaaatacatgtcaatccgctttccggggggacagcaac
aacatacattccgcgttatgtaatgccctactgtcatggggaactcctcagaaccaatat
gaaagtggtaaaccaaggtactggcctggaccaattcgtcataaccctggtgtaaaatca
gcggagccgattgtgaagatgaatggacaacaggggccatgtggaccctcggctttctgt
gttgaacggggtcctcttcattccggggccccgacaccaggtccttggggacagcccttc
tatgcctccgtgagccacctggttaacatggtgcagcgtggggcccggcgccgacggagc
agcctcatcagacacatcactgggcacgctctgcctcagactgagagtgctgcacaaccg
gccgggtttggactcaaatttaacaaatgcgcccaggtcggggagggcacggagttccct
catctgacgttctttctgctcatccacaacatcgggcctccagggggcaccaacctgtcc
cagctggccatcagggactctgtctctgggatagcaccgctgcagagtggggggacagtg
gtggagaaaggcttccagacctttaccatcgattcactgccagctgggtctcggtacact
gtcacttatacggccctcatcaagggtcacaagagcgtggtcctggacctgccagccttc
ctcactttctccaacgcttcgctgaatgacgtcagtatgtttggtccggtggtggctaat
ttgaccctgaggctgaactccacagacaagatttaccccaatcacggtgtccacttcgct
gggtttgtctgtggtttcttcctgtccttgttgttgctgtccctgggatttcttgccata
aacctgatatgtgcccgagccaggaaaaactctctgcagcaaaggataaaacgaggtgat
tcagaccccgagtatgcagtgtgcaacatgagtgagacggtcaaagaagaggcagcattt
gaagacaaaatggtggacatcatggtgcttgaagaaccccagaacatgtatcaagctctg
gagaacttggaaatgtccagcctgctgcaggccacctctagcctcgagtccagtcgcgtc
cagatgtacaaggacgtaattgccgccctgctggcctcactgcgctcccagaaccacatg
tcccagcaggccgagcagcgcctcctgagcgtactccacggccagctgatgggcatggag
ggcaagctgaaggaggagcatgtggcgcgcatggccaccctagcggcccagtgtaacctg
gagacccgagagcagatggaggcggagcaccgcagggaggcccaggagaaggcccaggcc
gaggtgctgtttcgacacgccgaccaacaggagcttctccaagtgagtgtcctcctggag
aagctccacaagctgaaccagagtcagctccagcgcagcctgctggtgaaacacgaggag
gcctcggctcgggttcagaggcaaatagtggagtggaggagggtagagctgcacaagatc
ttctcagaggagctggaggaggccaccaggatgggcgagctggagaagaacgtggctcgg
agtctcctgcacgactacttcacctgccagaatcaactggaggaggtgctggatgtggtc
ctggccaaccagcgttgcatgctaggggaacgccacgcccagaggaggttcctggttcac
agtctctacagcctaaaaggcctcatctctgagaccttctccaagacctccagccaaatg
gagaactgcttcaaggaacatgggagggggagcgatgtgtccgaggagcagagggagcag
cagctggacaaggtccagaaagagctggttctggtgaagcagcgactggatgaggctctt
aaccgtgagaggagggccatgcactgtggcctggtgaagaagaggagggaactcctctca
gacatgctccagggccacaagcagaggcaaagggagctctctgccctatctcggggaggt
ctggagggggagagggcagaggtggatccggctcagcacctcctctgctggcagagctta
ttgaccacccagtgccaggagctgggggagctcatcaacaacctggatgaggaggcagct
gccgacatccgcaaggtcaccatgcggctgatccacagctccatggcggaggtgaaagtg
attcaggctgccagtcaggctttgctggccctggggcccccccaacagccagatgcgggg
gccaccgcgggggctggcaccagcgctctctctcaggcccaggagaggctccacctggag
ggaaagggggccgtgagaatcctccaggcctccagggactccctgcgccagggcatgatg
agagagcagcgggcgcagctggagatgagggccagggcacgggcctttttccggtctctg
tgctcgtctcagctcaccttgtccgacgaggacctgctgcgtatgatgctggagttccag
aaatgtctgtcccggatggaccactgcctggtggtgccgcacgctctgtcccgctccaaa
ctgcagacagctttgacctcctggaggaaggaggtgctggaggagcagactgagccgttg
cagcagcctgagaacaaaacaaggccaagagggaaatccactgaggacagacagagagca
ggcccctctgaactcttgctcttccggaagaagatggaaggcagaatccagctgttcgag
aaagaaaaggagatggagaacaccattatggagaaggtgctggaagagatgcaaggtgag
cgggaggttgagctccagagccaggtggatggcctggccgtgcagatggctgcactccac
taccagaaggctgagagaaggaccagggtcctggagacatccagagccctgctcaccgtc
cagagcctcattacagaggagctacgtgccagcaggagtctggcctccgcccccatagcc
cagagcatccagaaccactatctgggtttggaagaagcagagcaccagctccagagagag
cacgcagagctggagagtctggaaactgggccaagcaaacctccagaacacaaactaccc
aaacactcagacgcctctgcaaatgaagacgagggagaggaggaagatgggaggctgttc
cgaatagaacgtgacagccgcatggctgctatactacacgaggccttatacaaatgtgat
caggtcaccagtctgcagatggagaggttacaagaagccaacgccaggagtcaggctatg
gaggatctcaaggagcaactggagctgaagaggctctactctaactgtgaccaggacctg
gaattcgcggccaggttggtaaggcagagccagatctcaactgaggttctcctggaggct
ctccgtctgctcctccccactctcccagagtcggagctgctctccctcatcgatgccctc
tgtcccaagcagcctacccttctggggtccacagagcagcagaacccaagttggccagag
ggagcgggcaaatcactgctggtcagactgagggcggaaatgattgggaggaatgtctca
gcccactcaacaatcctggagcaaaaccagttccaggagaagaggccgagtctgttggag
aggcttttcatgaatcccagacctgaggctcctagggacatcatgccagtgttggtccag
gaaaaggggagggagggagctactctactcactccacaacaacttgcttccaaaccagtt
gtgactggaacgagccgaaccccagcctcggagcagctccaagactctgttctgatttca
gtgggaggtgcatcggtgaacagtgaaactgtgtttgactcccaacgtacaaccgcagcc
tccacctttggttcagccagcggtgcggtgatggtggacatccccactactggagagagg
gtgtttgtgttccgctcaccgcctgatcccctgagcacgcaggggaccaccgactgtaag
aggaagaagagaaacttccttaatttgaagaagggttcggtggcccccatggaccgacct
tga

DBGET integrated database retrieval system