KEGG   Esox lucius (northern pike): 105016898
Entry
105016898         CDS       T04894                                 

Definition
(RefSeq) protransforming growth factor alpha isoform X2
  KO
K08774  transforming growth factor, alpha
Organism
els  Esox lucius (northern pike)
Pathway
els04010  MAPK signaling pathway
els04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105016898
   04012 ErbB signaling pathway
    105016898
SSDB
Motif
Pfam: EGF SSP160
Other DBs
NCBI-GeneID: 105016898
NCBI-ProteinID: XP_010879350
UniProt: A0A3P8X8I2
LinkDB
AA seq 197 aa
MMNRAFWDAIFLITGSLFTYGRGHDNSTVSTNSTMTTTSPVTTTITTMHVTTSSTTTAST
STASKTTIPIKKFVAAAVRSHFDDCPDSHNHFCFHGTCRFLILEETPACVCHQGFVGMRC
EHADLLAVVATNHRKQTVATVLVLCVIGCVLTMLLCTLLHCLWSRDGFVRRHGLHCAPDK
KGSMMCQGAYCHSVTVV
NT seq 594 nt   +upstreamnt  +downstreamnt
atgatgaatcgggctttctgggatgcaatctttcttattaccgggtccctctttacctat
ggaagggggcatgataattctacagtttctactaattctactatgacaaccacgtctcct
gtgactactaccattaccactatgcatgttactacctcttctactaccactgcaagtact
tcaactgcctctaaaaccaccattccaattaaaaagtttgtggcggcagctgttcgatca
cacttcgatgactgtccggactcccacaaccacttttgtttccatggaacctgtcgtttc
cttattctggaggagacgcctgcttgtgtgtgtcaccaaggttttgtaggaatgcgatgt
gagcatgctgatctgctagccgtggtggctactaatcacaggaaacagacagtcgccacc
gtgctagttctgtgcgtgattggctgtgtcttgacaatgctgctctgcacgcttttacat
tgcctgtggagtcgggacggttttgtgcggaggcacggacttcactgtgccccagacaaa
aaaggcagtatgatgtgccaaggagcctactgtcactctgtcactgttgtttga

DBGET integrated database retrieval system