KEGG   Esox lucius (northern pike): 105017105Help
Entry
105017105         CDS       T04894                                 

Gene name
sdhb
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
els  Esox lucius (northern pike)
Pathway
els00020  Citrate cycle (TCA cycle)
els00190  Oxidative phosphorylation
els01100  Metabolic pathways
els01200  Carbon metabolism
Module
els_M00009  Citrate cycle (TCA cycle, Krebs cycle)
els_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
els_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:els00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    105017105 (sdhb)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    105017105 (sdhb)
Enzymes [BR:els01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     105017105 (sdhb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_9 Fer4_7 Fer4_18
Motif
Other DBs
NCBI-GeneID: 105017105
NCBI-ProteinID: XP_010879758
LinkDB All DBs
AA seq 282 aa AA seqDB search
MSVICFSSLGRCTAMAYRSSAGIVAVRYAQTAAATATQPKIKKFQVYRWDPDTVGDKPRM
QTFEIDLNTCGPMILDALIKIKNEMDGTLTFRRSCREGICGSCAMNINGGNTLACLNKID
TNTSKVTKIYPLPHMYVVKDLVPDMSNFYAQYKSIEPYLKKKDETNEGKEQYHQTVEDRQ
KLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDEFTEERLSQLQDPF
SLYRCHTIMNCTRTCPKGLNPGLAIAEIKKMMAMYKEKRAAA
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtgatttgtttttcgtccttgggtcgctgtaccgcaatggcataccgttcttcc
gctggaatagtggcggtccggtatgcccagacagcagcagccacagccacacagcccaaa
atcaagaagtttcaggtgtaccgctgggatccagacacggttggggacaagcctcgcatg
caaacctttgagattgatctcaacacttgtggccccatgatattagacgccctcatcaag
atcaagaatgagatggatggcactctaactttccgtcgatcgtgcagagagggtatctgt
ggatcatgtgcaatgaacatcaatggaggcaacaccctggcctgtctgaacaagattgac
accaacaccagtaaggtgaccaaaatctaccccctaccgcacatgtatgtggtcaaggat
ctggtccctgacatgagtaatttctatgctcagtataagtcaatcgagccctacctgaag
aagaaggatgagaccaatgaggggaaggagcagtatcatcagactgtggaggacagacaa
aaactggatggcttgtatgaatgcatcctgtgcgcgtgctgcagcacgagctgccccagc
tactggtggaacggagacaagtacctgggacctgctgttctgatgcaggcctaccgctgg
atgatcgactcacgggacgagttcacggaagagcgtctttcccagctgcaggatcccttc
tcactctaccgctgtcacaccatcatgaactgcactaggacctgccccaagggtctgaat
ccaggactggcgattgcggagataaagaagatgatggcaatgtacaaggagaaaagagct
gctgcttga

DBGET integrated database retrieval system