KEGG   Esox lucius (northern pike): 105017129
Entry
105017129         CDS       T04894                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1 isoform X1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
els  Esox lucius (northern pike)
Pathway
els04012  ErbB signaling pathway
els04068  FoxO signaling pathway
els04110  Cell cycle
els04115  p53 signaling pathway
els04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    105017129
   04068 FoxO signaling pathway
    105017129
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    105017129
   04115 p53 signaling pathway
    105017129
   04218 Cellular senescence
    105017129
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 105017129
NCBI-ProteinID: XP_010879795
UniProt: A0A3P9A2X1
LinkDB
AA seq 176 aa
MCRTGTTMASRTSVLTYLGESSARRNLFGPVDHEQLQQEYQDALNRDLEAACYRWGFDFR
SEKPLAQGHFQWDGVPEAGVPLLYRPCAVGQGGAQRVGGPADSAGRVWVGLSHCGRENIS
CTPVKYRGNCHNLEETPEKEENKNSNENGLKRKQTNLTDFYQSKKRVVGTPRKSGQ
NT seq 531 nt   +upstreamnt  +downstreamnt
atgtgtagaaccggaacaaccatggccagtcgtacgagcgtcctgacctatctgggggaa
agttctgccaggcggaacctgttcggcccagtggaccacgagcagctgcagcaggagtac
caggacgccctgaacagagacctggaggcggcctgctaccgctggggctttgacttccgc
tcagagaaacctcttgctcaaggacacttccagtgggacggggttccagaggccggtgtg
ccactgctctaccgtccctgcgcggtgggtcaggggggggcacagagggtgggaggaccg
gcggactctgctgggcgggtctgggtggggctgtcgcactgtggcagggagaacatttcc
tgcacccccgtgaagtacagaggtaactgccataacctggaggagacgccggaaaaggag
gagaacaagaacagcaatgagaacggtctgaagaggaaacagaccaacctcacagacttc
taccaatccaagaagagagtagtgggtacgccacgcaagtcaggccaatga

DBGET integrated database retrieval system