KEGG   Esox lucius (northern pike): 105017289
Entry
105017289         CDS       T04894                                 

Gene name
ccnd1
Definition
(RefSeq) G1/S-specific cyclin-D1 isoform X1
  KO
K04503  G1/S-specific cyclin-D1
Organism
els  Esox lucius (northern pike)
Pathway
els04068  FoxO signaling pathway
els04110  Cell cycle
els04115  p53 signaling pathway
els04218  Cellular senescence
els04310  Wnt signaling pathway
els04340  Hedgehog signaling pathway
els04371  Apelin signaling pathway
els04510  Focal adhesion
els04530  Tight junction
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    105017289 (ccnd1)
   04340 Hedgehog signaling pathway
    105017289 (ccnd1)
   04371 Apelin signaling pathway
    105017289 (ccnd1)
   04068 FoxO signaling pathway
    105017289 (ccnd1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    105017289 (ccnd1)
   04115 p53 signaling pathway
    105017289 (ccnd1)
   04218 Cellular senescence
    105017289 (ccnd1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105017289 (ccnd1)
   04530 Tight junction
    105017289 (ccnd1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 105017289
NCBI-ProteinID: XP_010880072
UniProt: A0A3P8Z0L9
LinkDB
AA seq 292 aa
MENQLLCCEVETIRRAYHDTNLLNDRVLQTMLKAEENYLPSPNYFKCVQKEIIPKMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSVEHTKKTRLQLLGATCMFLASKMKETVPLT
AEKLCIYTDNSIRPSDLLQMELLALNKLKWDLASVTPHDFIDHFLSKLPIHQNTKQILRK
HAQTFVALCATDVKFIANPPSMIAAGSVAAAVQGLYLKSTDGALSSENLTNFLSQVIKSD
PDCLRSCQEQIESLLESSLRQAQQQIVSTETKRIDEEVDLSCTPTDVRDVNI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaaaaccagctgttgtgctgtgaagtggagaccatcagaagagcttaccatgatacc
aacttactaaatgaccgagttctacagacaatgcttaaagctgaggaaaattaccttccg
tctccaaattacttcaagtgtgtccagaaagaaataatacctaagatgaggaaaatagtg
gctacatggatgttagaggtctgcgaggaacagaaatgcgaggaggaagtttttcccctg
gctatgaactacttggatagatttttgtctgtggagcacacaaagaaaaccagattacaa
cttctcggagctacatgtatgtttctggcctcaaagatgaaggaaacggtccctttaact
gcagagaagttgtgcatttacactgacaactccatccggcccagcgatcttttgcaaatg
gaactactggctttaaacaagttgaaatgggaccttgcatcagtaacacctcacgatttc
atagaccatttcctctccaagctaccaattcatcagaacaccaagcagatcctgcgcaag
catgcccaaacatttgtggctctctgtgctacagatgtcaagttcatcgccaaccctcca
tccatgatcgcagcaggcagcgtggcagcggcggtccaggggctgtatctaaagagcaca
gatggtgcgctgtcatccgagaacctaaccaacttcctgtcccaagttatcaagagtgac
ccggattgcctgaggtcgtgtcaggaacagatcgagtccctgctggagtctagtttgaga
caggcacagcaacaaatcgtctccacagaaacgaaaaggatagatgaggaggtggacctt
tcctgcacccccacagatgtgagggacgtcaacatttga

DBGET integrated database retrieval system