KEGG   Esox lucius (northern pike): 105017465Help
Entry
105017465         CDS       T04894                                 

Gene name
hesx1
Definition
(RefSeq) homeobox expressed in ES cells 1
  KO
K09354  homeobox protein expressed in ES cells 1
Organism
els  Esox lucius (northern pike)
Brite
KEGG Orthology (KO) [BR:els00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:els03000]
    105017465 (hesx1)
Transcription factors [BR:els03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, XANF
    105017465 (hesx1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain Homeobox_KN
Motif
Other DBs
NCBI-GeneID: 105017465
NCBI-ProteinID: XP_010880415
UniProt: A0A3P8YWL9
LinkDB All DBs
AA seq 177 aa AA seqDB search
MASSVVSCQIRRVEARPVFTIDHILGLDLNRPELRTVPLKLYRPWAELELPQQRNHTILN
GEHLLMIKQKEDAHDFNGKPQFRPTESFSRTLNWYIGRRPRTAFSNEQIEVLESVFLINS
YPGIGIREELAQRLLLDEDRIQIWFQNRRAKLKRSHRESQFLMVKKSIGDLEEKEEE
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atggcttcatctgtcgttagttgccagatcaggcgcgttgaggcaagacccgttttcacc
atagaccacatccttgggttggatttgaaccggccagaactacgcacagtgcctttgaag
ctgtatcgaccctgggcagaattggaactaccgcaacaaagaaaccacaccatattaaat
ggtgaacatttgttaatgataaaacagaaagaagatgcacatgatttcaacggtaaacca
cagtttaggcctacggagtccttcagcagaacattgaactggtatattgggcgcaggccg
cgaacggctttcagtaacgaacagattgaagtcttggagagtgtgtttctcatcaactct
tacccgggaattggaatcagagaagaactggctcaacggctgcttctggatgaggacaga
atacagatctggttccagaatcgtagggccaagttgaaacgttctcacagggagtcacag
tttctcatggtgaagaaatccattggagatctcgaggaaaaagaagaagaatag

DBGET integrated database retrieval system