KEGG   Esox lucius (northern pike): 105017837Help
Entry
105017837         CDS       T04894                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, platelet type isoform X1
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
els  Esox lucius (northern pike)
Pathway
els00010  Glycolysis / Gluconeogenesis
els00030  Pentose phosphate pathway
els00051  Fructose and mannose metabolism
els00052  Galactose metabolism
els01100  Metabolic pathways
els01200  Carbon metabolism
els01230  Biosynthesis of amino acids
els03018  RNA degradation
Module
els_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:els00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    105017837
   00030 Pentose phosphate pathway
    105017837
   00051 Fructose and mannose metabolism
    105017837
   00052 Galactose metabolism
    105017837
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    105017837
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:els01009]
    105017837
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:els03019]
    105017837
Enzymes [BR:els01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     105017837
Protein phosphatases and associated proteins [BR:els01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     105017837
Messenger RNA biogenesis [BR:els03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     105017837
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 105017837
NCBI-ProteinID: XP_010881063
LinkDB All DBs
AA seq 790 aa AA seqDB search
MAKRQDTKKFFENLSGSGKSIGVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYFIHEGYQG
MVDGGENIEEASWESVSSMLQVGGTVIGSARCKEFRSHEGRLKAAHHLVQHGITNLCVIG
GDGSLTGANLFREEWSGLLEELVQQGLIDQEAAQNNSELHIVGMVGSIDNDFCGTDMTIG
TDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVLIPEMPPED
GWEEQMCQKLSENRAGKKRLNIIIVAEGAIDCHNKPITTEYIKDLVVRCLGFDTRVTILG
HVQRGGTPSAFDRILASRMGVEAVLALLEASATTPACVVSLCGNQAVRLPLMECVQMTQD
VQKAMDEKNFEEAVRLRGRSFENNLNTYKLLSFRKADSELPHEENGSPYNSSFNVAVLNV
GAPAAGMNAAVRSAVRVGISEGHKMFAVNDGFEGFYKGQIKEIKWGDVGGWTGQGGSILG
TKRTLPAKYLDKIAEQIRIHNINALLVIGGFEAFLGVMELSAAREKYNEFCVPMVMVPAT
VSNNIPGSDLSIGADTALNAITDTCDRIKQSASGTKRRVFIIETMGGYCGYLASVGGLAA
GADAVYIYEEPFDIRDLQSNVEHLTEKMKTGIQRGLVLRNENSNVNFTTDFIYQLYSEEG
KGVFDCRKNVLGHMQQGGAPSPFDRNFGTKISAKAIQWISKKLKESYKEGKVFANTEDTA
CLLGMRRRALVFQPVVQLKEETDFVHRIPKEQWWLKLRPLMKILAKYKTSYDVSDSGQLE
HVTRIRPKKD
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagcggcaagacactaagaaattctttgagaatctctccggttctggaaaatcc
atcggcgttctgacgagcggaggagatgctcaaggtatgaatgccgcggtccgggctgtg
gtccgcatgggtatttatgtgggagccaaagtatatttcatccatgagggttaccagggt
atggtagatggtggagagaacatcgaagaggcttcctgggaaagtgtctcaagcatgctg
caagtgggtggcacagtcattggcagcgcccgctgcaaggagttccgcagccacgagggc
cgtctgaaggctgcccatcacctggtgcagcacggcatcaccaacctgtgtgtgatcggg
ggggatggcagcctcaccggcgccaaccttttccgagaggagtggagcggcctactggag
gaactggtccaacagggtctgattgaccaggaggctgcccagaacaactcagagctgcac
attgttgggatggtgggctccatcgataatgacttctgtggtactgacatgaccatcggg
acagactccgccctgcacagaatcattgaggtggtggacgccatcatgactactgcgcag
agtcaccagaggacgtttgtgctggaggtcatgggaagacattgtgggtaccttgctcta
gtaagtgctttggcttgtggggctgactgggtcctgatccctgagatgcctcctgaggac
ggatgggaggaacagatgtgtcaaaaactgtctgagaaccgcgccggtaagaaacggctc
aatatcattatcgtagcggagggggccatagattgccacaacaagcctatcactactgaa
tatataaaggatcttgtggttcgctgtctggggtttgacacccgggttaccatcctgggt
cacgtgcagagagggggaaccccatctgcctttgacaggatcctggccagtcgtatggga
gtggaggccgtcctggccctcctggaggcgtcagccaccaccccggcctgcgttgtgtct
ctgtgtgggaaccaggcagtccgtctgcccctcatggagtgtgttcagatgacacaagat
gtccagaaagccatggatgagaagaattttgaagaagctgtgagactacgtggcaggagt
ttcgaaaacaacctgaacacctacaaactcctctctttccgtaaagccgactcggagctc
ccacatgaggagaatggttcgccatataatagctcctttaacgtggccgtcctgaacgtg
ggagcccccgcggcgggcatgaacgctgccgtacgctcggccgtcagggtgggcatcagc
gaggggcacaagatgtttgccgttaacgacggttttgagggattctacaagggacagata
aaggagattaaatggggagatgtagggggctggacgggccaaggagggtcaatcctggga
acgaagagaacccttccagcaaagtatcttgataagattgctgaacaaatcaggatacat
aacatcaatgccttgctcgttatcggtggatttgaggccttcctgggagtcatggaactg
tcggccgcccgggagaaatataatgagttctgtgttcccatggttatggtccctgccacg
gtctccaacaatataccgggctctgacctcagcattggcgcagacacagctttgaatgcg
attacggatacgtgtgaccgcatcaagcagtcggccagcgggaccaagcggcgtgtgttc
atcatcgaaaccatgggggggtactgcgggtacctggccagtgtgggggggctggcagct
ggggctgacgccgtctacatctacgaggagcccttcgacatccgggacctccagtccaac
gttgaacatttgactgagaagatgaagacgggcatccagagaggcttggtgctcaggaat
gagaactcaaacgtgaactttaccacagacttcatctaccagctttactctgaggaaggt
aaaggagtgtttgactgcaggaagaacgtccttggccacatgcagcagggaggtgcgcct
tccccgttcgacaggaactttggaaccaagatttcagctaaagcaattcagtggatttca
aaaaaacttaaggagtcttacaaagaagggaaggtgttcgctaacacggaggacactgcc
tgtttgctgggaatgcgtcgcagagccctggtgttccaaccagtggtgcagctgaaagaa
gagacagactttgtccacaggatccctaaggagcagtggtggctgaagctccgccccctg
atgaagatcctggccaagtacaagacgagctacgacgtttccgactccggccagctggag
catgtgacccggatcaggcccaagaaggactga

DBGET integrated database retrieval system