KEGG   Esox lucius (northern pike): 105018279
Entry
105018279         CDS       T04894                                 

Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
els  Esox lucius (northern pike)
Pathway
els04068  FoxO signaling pathway
els04110  Cell cycle
els04115  p53 signaling pathway
els04218  Cellular senescence
els04310  Wnt signaling pathway
els04340  Hedgehog signaling pathway
els04371  Apelin signaling pathway
els04510  Focal adhesion
els04530  Tight junction
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    105018279
   04340 Hedgehog signaling pathway
    105018279
   04371 Apelin signaling pathway
    105018279
   04068 FoxO signaling pathway
    105018279
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    105018279
   04115 p53 signaling pathway
    105018279
   04218 Cellular senescence
    105018279
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105018279
   04530 Tight junction
    105018279
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 105018279
NCBI-ProteinID: XP_010881878
UniProt: A0A3P8Y047
LinkDB
AA seq 374 aa
MQFIQRCLPLICSVTTVTSLPQFAEGRGVNTVGPSLVTLLRASTQQMRQTETEKHILNYW
RSIHSLTLLGSFIAQATDEAEGMEHQLLCCEVETVRRAYQDTNLLNDRVLQTMLKAEDNY
LPATNYFKCVQKEIVPYMRRIVSTWMLEVCEEQKCEEEVFPLAMNFLDRYLSIEPTRKTR
LQLLGATCMFLASKMKETIPLTAEKLSIYTDNSIRPGELLQMELLVLNKLKWDLASVTPH
DFIDHFLSKLPIHPDTKQILRKHAQTFVALCATDVKFIANPPSMIAAGSVAAAVQGLHLK
SADNALSSQQLTDFLSQVIRSDPDCLRACQEQIESLLETSLRQAQRHTVSTETKNVDEEL
DLSCTPTDVRDVNI
NT seq 1125 nt   +upstreamnt  +downstreamnt
atgcaattcattcaaaggtgcttgcctttgatctgctcagtaacaacagtcacgtcattg
ccccagttcgccgaggggaggggagttaatacagtagggccgagtttggtaaccctcctg
agagcttcgacacagcagatgcgtcagacagagacagagaaacacatactgaactattgg
agaagcattcattcactcactcttttaggctcttttattgctcaagcgactgacgaagct
gaaggaatggaacatcagttgctgtgctgtgaagtggagaccgtccggagagcttaccaa
gacacaaacctgcttaacgacagagttttgcagaccatgcttaaagctgaagacaattat
ctcccggcaacgaactacttcaaatgtgtacagaaagagattgtaccctacatgagaaga
attgtttctacatggatgttggaggtgtgtgaggaacagaaatgcgaggaggaggttttt
cccctagctatgaattttttggacagatatttgtctattgaacccaccaggaaaacccgt
ctacagttacttggagctacctgcatgtttcttgcgtcaaagatgaaggagaccattccc
ctaactgctgagaagttgagcatatacaccgacaattccatcagaccgggcgaattgctg
caaatggaactactagtattgaacaaactgaaatgggatctagcctcagtgactccgcac
gatttcatagaccatttcctctccaaactacccatccatccggacaccaagcaaatcctg
cgcaagcatgcgcagacctttgtggctctctgtgctacagacgtaaaattcatcgccaac
cctccatcaatgattgcagcgggcagtgttgcggccgcggtccagggcctgcatttgaag
agtgcggacaacgcgctgtcatcccagcagctcactgacttcctgtcccaagtcatccgg
agtgacccggactgtttgcgagcgtgccaagaacagatcgaatccttactggagaccagt
ctccgtcaggcgcaacggcacaccgtttccacggagaccaagaacgtggacgaggagctg
gacctttcgtgcacaccaacggacgtgagggacgtgaacatctga

DBGET integrated database retrieval system