KEGG   Esox lucius (northern pike): 105018304
Entry
105018304         CDS       T04894                                 

Gene name
kitlg
Definition
(RefSeq) kit ligand
  KO
K05461  KIT ligand
Organism
els  Esox lucius (northern pike)
Pathway
els04010  MAPK signaling pathway
els04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105018304 (kitlg)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    105018304 (kitlg)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:els04052]
    105018304 (kitlg)
Cytokines and growth factors [BR:els04052]
 Growth factors
  Growth factors (RTK binding)
   105018304 (kitlg)
SSDB
Motif
Pfam: SCF SepQ Tmemb_cc2
Other DBs
NCBI-GeneID: 105018304
NCBI-ProteinID: XP_010881909
UniProt: A0A3P8Y6D1
LinkDB
AA seq 271 aa
MKKPKIWIRVCVHLLLCIITLVQSSEFGNAVTDDITSISLLKQNIPKDYKIPVSYIPEDV
GGMCWVTLNVFRLEVSLQGLAEKFGNISSNKYNISILIEMLKETRYHIKNLEAVMNDFEC
HYRDDQWQTGRYFHFVENILKTARSNRNSPEECDPPPCPTTAPTTTPLPYPSSEPVNYPT
KCDIAEKSCSTRTESLVSPEVLGKSLLSLLVIPIVAIVFLFVWKVKSRRNKDKPDENNSV
EGGLFTGIEGNVVPPLEETSEKNRLNIIETV
NT seq 816 nt   +upstreamnt  +downstreamnt
atgaagaagccaaaaatttggatacgcgtgtgtgtccatttattgctgtgcatcatcaca
cttgtccaatcaagtgaatttggaaacgctgtaacagatgacatcacaagcatttcacta
ttgaaacagaatatacctaaagattacaaaattcctgtgtcttatattcctgaagacgtg
ggtggaatgtgttgggtaacactaaacgtttttcgtttggaagtcagtttacaaggatta
gcagaaaagtttggaaacatttcatccaacaaatataatatcagcatattgatcgaaatg
ctgaaagaaacacgatatcacatcaagaacttggaggcagtcatgaatgattttgagtgc
cactacagagacgatcaatggcagacaggacgctattttcattttgttgaaaatattcta
aaaacagctcgttctaatagaaattcaccagaggaatgtgatccacctccctgtcccaca
acagcaccaacaacgacaccactaccatacccttcatcagaaccagtcaactatcctacc
aaatgtgacatcgcagaaaaaagctgcagtactcggacagagtctctggtctcgcctgag
gtactggggaaaagcctcttgtcactacttgtcattcctattgtagcaatcgtgtttctg
tttgtgtggaaggtgaaatcccggaggaacaaagataaaccagatgaaaataattctgtg
gaaggaggcctcttcacaggaattgaagggaatgtggtacctccactagaagaaacatct
gaaaagaacagattgaacatcattgagacggtgtaa

DBGET integrated database retrieval system