KEGG   Esox lucius (northern pike): 105018460
Entry
105018460         CDS       T04894                                 

Gene name
cdkn1b
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
els  Esox lucius (northern pike)
Pathway
els04012  ErbB signaling pathway
els04068  FoxO signaling pathway
els04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    105018460 (cdkn1b)
   04068 FoxO signaling pathway
    105018460 (cdkn1b)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    105018460 (cdkn1b)
SSDB
Motif
Pfam: CDI GvpH
Other DBs
NCBI-GeneID: 105018460
NCBI-ProteinID: XP_010882197
UniProt: A0A3P8ZQL2
LinkDB
AA seq 189 aa
MSNVRLSNGSPTLERTDARLSDHPKPTACRNLFGSVDHEELTRDLKGHLKEMEEAAAAKW
NFDFSSHTPLLNGKYEWKKVDSKDIPTFYNTQQRSAKGIYPSGNNNVDLNGNHSCVLGTP
RQPSENAERSETQFENKEQCTGQRKRPACHDPLSQNKRSHSSSDEVTCCPGLMRSVEHTP
RKTSPRTQT
NT seq 570 nt   +upstreamnt  +downstreamnt
atgtcaaatgttcgactttcaaatgggagcccgacattggaaaggacggatgctcgtttg
tcagatcaccccaaacccacagcctgcaggaacctttttggttcggtggatcatgaagag
ttaacgagggatttaaagggacatttgaaagagatggaagaggctgctgcagcgaaatgg
aacttcgatttttcaagtcacacaccgctattgaacgggaaatacgaatggaaaaaagtg
gattctaaagacattccaactttctataacacacaacaacggtcggcgaagggaatttac
ccttctgggaataacaatgtggatctcaatggcaatcatagttgtgtgttaggaactcct
cggcagccatctgaaaacgcagagaggtccgagacccaatttgagaataaagagcagtgc
accggccagagaaaaagacctgcctgccacgaccccttgtcccaaaataaaaggtcccac
agcagttcggatgaagttacttgttgcccaggcttgatgcgttctgtagaacacacaccc
aggaaaaccagtcccaggactcaaacgtga

DBGET integrated database retrieval system