KEGG   Esox lucius (northern pike): 105018504Help
Entry
105018504         CDS       T04894                                 

Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase 2
  KO
K05625  transglutaminase 2 [EC:2.3.2.13]
Organism
els  Esox lucius (northern pike)
Brite
Enzymes [BR:els01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     105018504
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 105018504
NCBI-ProteinID: XP_019896008
LinkDB All DBs
AA seq 680 aa AA seqDB search
MAGQNGIFMGIDLRCQVNNHTHRTEEMDLERLLVRRGQPFSLALQCSTPLNPENKLAMVL
HLGKEGQVVVKVLETRAVHDKWWFRQQGAQSEVLLTVHSPADAPVGLYSMTVLLLSPDGH
ILEQTTLETFYLLFNPWCKADSVYLPDEELLEEYILNENGILYQGSWNQISSLPWNFGQF
EQDVVDICFEILDNSPSALKNPEMDTANRADPVYVSRTITAMVNANDDRGVVSGRWDGKY
DDGVPPTRWTGSVPILRRWSEAGAQRVRYGQCWVFSGVACTILRCLGVPTRPVTNYSSAH
DTDGNLCVDYLYDNQLESVSEGRKDMIWNYHCWVESWMDREDLPEGYGGWQALDPTPQER
SDGVYCCGPCPVKAVRDGDVGIKYDAPFVFSEVNADLVTWIVYPDGQRSQVSLNQKTVGR
NISTKSVYGDYREDITKHYKYPEGSVKEREVFEKAGRRVSQLKAGKGQLELKIKHAQAIL
GTDFDVIVEVHNVGGEDTVAQLTVTSNAVTYNSLHRGECQRKTASLTVPAQKAHKEVLRL
HYDHYGACVSEHNIIRVTALVQPSGQQSAILQEVNISLSMPQLHVKVVGDAVVSRKLIAH
ISFTNPLPITLRGGVFTAEGAGLTSAREIQAPGDIGPGQEVKVKLSFKPTRAGLRKLLVD
FDADRLKDVKGMATVIVRNK
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atggctggccaaaacggcatattcatggggattgacctgcgctgccaggtgaacaaccac
acccatcgtacagaggagatggacctagaaaggctgcttgtccgtaggggacagcccttc
tccctcgccttacagtgctccacacccctaaaccctgaaaacaaactagccatggtcctg
cacctgggtaaggaaggtcaggtggtggtgaaggtgctggagacccgtgctgttcatgat
aagtggtggttccgtcagcagggggctcagagtgaggttctgttgacggtccacagccca
gcagatgcccctgtgggactctacagcatgactgtgctgctcctctcccctgatggacac
atcctggaacagaccacactagagacattctacctgctcttcaatccctggtgcaaagct
gactctgtgtacctccctgatgaggagctactagaggagtacatcctgaatgaaaatggc
atcctttaccagggctcctggaaccagatctcctcactgccctggaacttcggacagttt
gaacaagatgtggtggacatctgttttgaaatcctggacaactcaccctctgccctgaaa
aacccagagatggacacagccaatcgagcagacccagtgtatgtgagccgaacaatcacc
gcaatggtgaacgccaacgatgatcgtggcgtggtgtcaggccgctgggacgggaagtat
gacgacggcgtgccgcccacacggtggactggcagtgtgcccatcctccggcgctggagc
gaggccggagctcagagggtgcgctacggacagtgctgggtcttctcaggtgttgcctgc
acaattctccgctgtctgggcgtacccactcgccctgttaccaactactcctctgcccac
gacaccgacggcaacctgtgtgtggactacctgtatgacaatcagctggagagtgtgtcc
gagggaaggaaggacatgatctggaactaccactgttgggtggagtcctggatggatcga
gaggatcttcctgaaggctacggtggatggcaggctctggaccccaccccgcaggaaagg
agtgacggagtgtactgttgtgggccctgtccagtgaaggcagtgagggacggtgatgta
gggattaagtacgatgcaccgttcgtgttctctgaggttaacgcagacctggtcacctgg
atcgtctacccagatggccaacgctctcaagtttccctcaaccagaagacggttggccga
aacatcagcaccaagagtgtgtatggagactacagagaggacatcactaaacattacaaa
taccctgaaggttcagtgaaggagcgtgaggtgtttgagaaggcaggccgccgggtgtct
cagctgaaggcagggaaaggccagctggagctgaagatcaaacatgcgcaggccatcttg
ggaacagactttgacgtgatagtggaggtgcacaacgtgggtggtgaagacaccgtggcc
cagctcactgtgacatccaacgccgtcacctacaacagcctccaccgaggggagtgccag
aggaagaccgccagtcttacggtgcctgcccagaaagctcataaggaggtcctgcgtcta
cactatgaccactacggagcatgtgtgtctgagcataacatcatcagggtcacagcactg
gtccagcccagcggccagcaaagcgccatcctgcaggaggtcaacatttcactgagcatg
ccccagcttcatgtcaaggtggtgggagatgcagttgtatctcggaaattgattgctcac
atcagcttcactaacccactgcccatcacgctaagagggggagtgttcactgcagagggg
gcggggctgacgtcagcacgggagattcaagcaccaggtgacattggcccaggtcaagag
gtgaaagtcaagttgtcctttaagccaacgcgtgctggcctgagaaagctgttggtagat
tttgatgcagatagactcaaggatgttaagggcatggctactgttatagtgcgaaacaag
taa

DBGET integrated database retrieval system