KEGG   Esox lucius (northern pike): 105018700Help
Entry
105018700         CDS       T04894                                 

Gene name
gsto1
Definition
(RefSeq) glutathione S-transferase omega-1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
els  Esox lucius (northern pike)
Pathway
els00480  Glutathione metabolism
els00980  Metabolism of xenobiotics by cytochrome P450
els00982  Drug metabolism - cytochrome P450
els00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:els00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    105018700 (gsto1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    105018700 (gsto1)
   00982 Drug metabolism - cytochrome P450
    105018700 (gsto1)
   00983 Drug metabolism - other enzymes
    105018700 (gsto1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:els02000]
    105018700 (gsto1)
Enzymes [BR:els01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     105018700 (gsto1)
Transporters [BR:els02000]
 Other Transporters
  Pores ion channels [TC:1]
   105018700 (gsto1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C GST_C_2 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 105018700
NCBI-ProteinID: NP_001290747
UniProt: C1BXG1
LinkDB All DBs
Position
LG19
AA seq 239 aa AA seqDB search
MASEKCLAKGSCAPGPLAKGQIRLYSMRFCPFAQRTRLVLHAKGIKHETVNIHLKDKPYW
YFENNPMGLVPTLETSSGQVIYESLITCEYLDEVYGEKKLLPADPFEKAQQKMLLDYYSK
MIQLFYKIPTGKNKGEDISVLEEELENKFVWLNKELVNKKTQFFGGDAITMIDYMMWPSF
ERLEMFGLKHCLDSTPELKKWTERMSEDQSVKATMHPIETHKAFGKSYFEGKPDFDYGL
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atggcctctgaaaaatgtttggccaaaggaagctgtgctcccggcccattagccaaaggt
caaatcaggctttacagtatgagattctgcccatttgcccaaagaaccaggctagtgctt
catgccaaaggaatcaagcatgaaactgtcaacattcatttgaaagacaaaccatactgg
tattttgagaacaaccctatgggtcttgttccgacactggagacttcaagtggtcaggtg
atctacgagtctctaatcacctgtgaatacctagatgaggtctatggagagaaaaagctg
cttccagctgatccttttgagaaggcccagcagaaaatgctgttggactattactctaag
atgatacagttattctacaagataccgacagggaaaaataaaggagaagacatttcagta
ctggaagaggagctggaaaataaatttgtctggttgaacaaagaacttgtcaataagaag
acccagttctttggtggagatgcaatcacaatgatcgattacatgatgtggccatcgttt
gagaggctagagatgttcggattgaagcactgtctggatagtacccctgagctgaagaag
tggacagagcgcatgtcagaggatcagtccgtcaaagccaccatgcaccccattgagaca
cacaaggcctttgggaagagctactttgaagggaaacccgattttgactatggcctgtag

DBGET integrated database retrieval system