KEGG   Esox lucius (northern pike): 105018981
Entry
105018981         CDS       T04894                                 

Definition
(RefSeq) apoptosis regulator Bcl-2
  KO
K02161  apoptosis regulator Bcl-2
Organism
els  Esox lucius (northern pike)
Pathway
els04115  p53 signaling pathway
els04140  Autophagy - animal
els04141  Protein processing in endoplasmic reticulum
els04210  Apoptosis
els04217  Necroptosis
els04261  Adrenergic signaling in cardiomyocytes
els04340  Hedgehog signaling pathway
els04510  Focal adhesion
els04621  NOD-like receptor signaling pathway
els05132  Salmonella infection
els05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:els00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    105018981
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    105018981
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105018981
  09143 Cell growth and death
   04210 Apoptosis
    105018981
   04217 Necroptosis
    105018981
   04115 p53 signaling pathway
    105018981
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105018981
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    105018981
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    105018981
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    105018981
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    105018981
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:els01009]
    105018981
Protein phosphatases and associated proteins [BR:els01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     105018981
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 105018981
NCBI-ProteinID: XP_010883128
LinkDB
AA seq 225 aa
MADDDNRFIVEKYICHKLLKRGYAWDFEDAEEEDGANNGSMISPPPGLVRRIHGASKAGQ
GSVPHISKWLSQPDPHAAIHRVLREAGDELERLYQPDFLEMSHQLYLTSSVAERRFREVI
DELFRDGVNWGRIIAFFEFGGTICVECVNKEMTSQVDHIAGWMTEYLNGPLHSWIQENGG
WEAFVELYDRQRDSVFCSWPSIKTVFGLAALGAASLTIGAYLTQK
NT seq 678 nt   +upstreamnt  +downstreamnt
atggcagacgacgataaccgttttatagtggaaaagtacatttgtcacaaactcttaaaa
cggggatatgcatgggatttcgaagatgcagaggaggaagatggtgctaataatgggtcg
atgatttctcctccgccgggtttggtacggcggattcatggggccagtaaagccggacag
ggcagcgttccccatatttccaaatggctctcccaaccagacccgcatgcagctattcac
agagtgttgcgtgaggccggggacgaactcgaaagactgtaccaacccgactttttggag
atgtcacaccagctgtatctgacgtcctctgtggccgagaggagattcagagaggttata
gacgagctgttcagagacggagttaactggggacgtattatcgctttcttcgagttcggg
ggcacaatatgcgtggaatgcgtgaacaaggaaatgacttcgcaggtggaccacattgcc
gggtggatgacagaatatctaaatggacccctgcacagctggattcaagaaaacggggga
tgggaggcctttgtggagctctatgacagacagagggactctgtgttctgttcatggccc
tccatcaagactgtctttggcctggctgcactgggggctgcaagcctcaccattggagca
taccttacacagaagtga

KEGG   Esox lucius (northern pike): 105027305
Entry
105027305         CDS       T04894                                 

Definition
(RefSeq) apoptosis regulator Bcl-2
  KO
K02161  apoptosis regulator Bcl-2
Organism
els  Esox lucius (northern pike)
Pathway
els04115  p53 signaling pathway
els04140  Autophagy - animal
els04141  Protein processing in endoplasmic reticulum
els04210  Apoptosis
els04217  Necroptosis
els04261  Adrenergic signaling in cardiomyocytes
els04340  Hedgehog signaling pathway
els04510  Focal adhesion
els04621  NOD-like receptor signaling pathway
els05132  Salmonella infection
els05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:els00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    105027305
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    105027305
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105027305
  09143 Cell growth and death
   04210 Apoptosis
    105027305
   04217 Necroptosis
    105027305
   04115 p53 signaling pathway
    105027305
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105027305
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    105027305
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    105027305
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    105027305
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    105027305
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:els01009]
    105027305
Protein phosphatases and associated proteins [BR:els01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     105027305
SSDB
Motif
Pfam: Bcl-2 Bcl-2_3 DUF4350 BH4
Other DBs
NCBI-GeneID: 105027305
NCBI-ProteinID: XP_010897651
UniProt: A0A3P9AAB2
LinkDB
AA seq 229 aa
MANENPYDSRVIVENYIYDKLLKNGFVWEFQTENQSRNNVFEDPSPPNSPELFARRLQPP
AAGEDNDPQFANRIPQPDPHARLHRVLRDAGNEIERMYQRDFAEMSGQLHITPSTAHGRF
TAVIDELFSDGVNWGRIVAFLEFGGTMCVESVNREMTPQVNNIVHWMTEYLNGPLQNWIQ
ENGGWDAFVEIYGQKRGSLFHSWPFLKTMFSLAALGAAGVTIGAMFTQK
NT seq 690 nt   +upstreamnt  +downstreamnt
atggcaaacgagaatccatatgacagtcgcgtcattgtcgaaaattacatctatgataaa
ctgttgaagaatggatttgtttgggaatttcaaacagagaaccaatctcgaaataacgtc
tttgaggatccctctccccccaactcccccgaactttttgcacggaggctccaacctccc
gccgctggcgaggacaacgaccctcagttcgcaaataggatcccgcaaccggacccgcac
gcccggctccacagagtcctccgcgatgccgggaacgagatcgaaagaatgtatcagcgg
gactttgcagagatgtcggggcagttgcatattacgcccagcacggcacatggacgattt
accgcagtaatagacgaactgttcagcgacggtgtaaactggggtcggattgtggctttc
cttgagtttggagggacaatgtgcgtggagagcgtcaaccgggagatgacgccccaggtg
aacaacatcgtccattggatgacggagtacctgaatggacccctgcaaaactggatccag
gagaatggtggatgggatgctttcgtggagatctatgggcagaagaggggctctctcttc
cattcatggcctttcctcaagaccatgtttagcttggccgccctgggggcagctggagtc
accattggagccatgttcacccagaagtga

DBGET integrated database retrieval system