KEGG   Esox lucius (northern pike): 105019148Help
Entry
105019148         CDS       T04894                                 

Gene name
aldh2
Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
els  Esox lucius (northern pike)
Pathway
els00010  Glycolysis / Gluconeogenesis
els00053  Ascorbate and aldarate metabolism
els00071  Fatty acid degradation
els00280  Valine, leucine and isoleucine degradation
els00310  Lysine degradation
els00330  Arginine and proline metabolism
els00340  Histidine metabolism
els00380  Tryptophan metabolism
els00410  beta-Alanine metabolism
els00561  Glycerolipid metabolism
els00620  Pyruvate metabolism
els01100  Metabolic pathways
Module
els_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:els00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    105019148 (aldh2)
   00053 Ascorbate and aldarate metabolism
    105019148 (aldh2)
   00620 Pyruvate metabolism
    105019148 (aldh2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    105019148 (aldh2)
   00561 Glycerolipid metabolism
    105019148 (aldh2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    105019148 (aldh2)
   00310 Lysine degradation
    105019148 (aldh2)
   00330 Arginine and proline metabolism
    105019148 (aldh2)
   00340 Histidine metabolism
    105019148 (aldh2)
   00380 Tryptophan metabolism
    105019148 (aldh2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    105019148 (aldh2)
Enzymes [BR:els01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     105019148 (aldh2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 105019148
NCBI-ProteinID: XP_010883396
UniProt: A0A3P8Z4Y9
LinkDB All DBs
AA seq 518 aa AA seqDB search
MLRTVLIRTLPRVFGISKCQYSAATIPKPSAQPEVHYNKLFINNEWQDAVSKKSFPTINP
ATGEVICLVAEADKADVDKAVKAARDAFRFGSPWRRMDASDRGLLLNRLADAIERDSAYL
AELETLDNGKPYAVSYSVDVPMVVKCLRYYAGWADKWEGKTIPIDGDFFCYTRHEPIGVC
GQIIPWNFPLLMQAWKLGPALATGNTVVMKVAEQTPLTALYVASLIKEVGFPPGVVNILP
GMGPTAGSAIASHMDVDKVAFTGSTEVGHLIQQASGASNLKKVTLELGGKSPNIIMSDAN
MADAVEQSHFALFFNQGQCCCAGSRTYVQDTIYDEFMERSVQRAKNRVVGDPFNLKTEQG
PQVDEEQFKKIIGYISSGKREGAKLMCGGGVAADRGYFIEPTIFGDVQDSMTIAREEIFG
PVMQILKFKTVEEVIDRANDTKYGLAAAIFTKDIDKAHYISNGLRAGTVWINCYDVFGAQ
APFGGYKYSGNGRELGEYGLDNYTEVKTVTIKVPQKNS
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgctcagaactgtgttaattcgaactttgcctcgagtctttggcatttccaaatgtcag
tattcggcggccacgatccccaaaccaagtgcacagccagaagtgcattataacaagctg
ttcatcaataatgaatggcaggatgctgtcagcaagaagtccttccccactatcaaccca
gctacaggagaggttatctgtttggtggctgaggcagacaaggctgatgtggacaaggct
gtgaaagctgccagggatgctttcaggtttgggtcaccatggcgacgcatggacgcgtca
gaccgcgggctacttctgaacaggctggcagacgccatcgagagagactccgcctactta
gcggaactggagacccttgacaatggaaagccctatgctgtgtcctacagtgtggatgtc
cccatggtggtaaagtgcctgagatactatgcaggatgggcagataagtgggaggggaag
acaatacccattgatggagacttcttctgctatacccgtcatgagcccattggtgtgtgt
ggccagataatcccgtggaacttccctctgttaatgcaggcgtggaagctggggccagct
ctggctacaggcaacactgtggtgatgaaggtggctgagcagacccccctcactgccctg
tatgtggccagtctcatcaaggaggttggattcccacctggtgtggtgaacatcctccct
ggtatgggcccaactgctggttctgccatagcttcccacatggatgtagataaagtagcc
ttcacaggatctactgaggtgggtcatctgatccagcaggcatctggtgctagcaacctg
aagaaagtcactcttgagctgggtggaaagagtcccaacatcatcatgtctgatgctaac
atggcggacgctgtggaacagtcacactttgccctgttctttaatcagggccagtgctgt
tgtgccggctcccgtacatatgttcaggacaccatttatgatgagtttatggagcgcagt
gtgcagcgggccaagaatagagtggtgggagaccccttcaacctgaaaactgagcagggt
ccccaggtggacgaggaacagttcaaaaagattattggctacatcagcagtgggaaacgt
gagggggccaagctgatgtgtgggggaggggtggctgcagaccgtggctacttcattgaa
ccaaccatctttggtgatgtccaagacagtatgaccatcgcccgtgaggagatttttggg
ccagtgatgcagatactgaagttcaagactgtcgaggaggtaattgatagagccaatgac
acgaagtacgggctggcagccgccatcttcaccaaggacattgacaaggcccactacatc
tctaatggacttcgtgctggcactgtctggattaactgctacgatgtatttggagcacaa
gccccctttggtggctacaaatattctggtaacggtcgtgagcttggagaatatggcctg
gacaactacacagaagtgaaaacagtaacaatcaaggtccctcagaaaaactcgtga

DBGET integrated database retrieval system