KEGG   Esox lucius (northern pike): 105019975
Entry
105019975         CDS       T04894                                 

Definition
(RefSeq) zinc finger protein GLI2 isoform X1
  KO
K16798  zinc finger protein GLI2
Organism
els  Esox lucius (northern pike)
Pathway
els04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    105019975
Transcription factors [BR:els03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 GLI-like
    105019975
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 FOXP-CC zf-C2H2_4
Other DBs
NCBI-GeneID: 105019975
NCBI-ProteinID: XP_019898115
LinkDB
AA seq 1507 aa
MSRMETSASTATEKKELKGAGLDGNGFADLPKKPSPSAVTRAPHHMFPTFHTPIPIDMRH
HEGRYHYEPHSLHAMHGPALGGSPVISDGISLIRLSPHAPGTGESPFSQPHPYVSHHMEQ
YLRSMHSSPSLSMISAARGLSPAELAHEHLKERGLFGLPPPPPGANPADYYHLMAGHRNP
YGDLLMQGAGASHLPDYITPVDVSRFSSPRLTPRLNRKRALSISPLSDASIDLQTMIRTS
PNSLVAYINNSRSSSAASSSYGHLSVGGISPSFTFPHAINPIAYQQLLSQQRGLSAFGHT
PPLIQPPPSFSSRQSALGLSSVPPSSHDPNLDSQSKNPCGDSAVSSTVNPMITKRSKVKM
EVECPRPLSPCSPQNHLGRTLDLKEDLDKDECKHEPEMEMVYETNCHWEGCSREYDTQEQ
LVHHINNDHIHGEKKEFVCRWEECTREQKPFKAQYMLVVHMRRHTGEKPHKCTFEGCCKA
YSRLENLKTHLRSHTGEKPYVCDHEGCNKAFSNASDRAKHQNRTHSNEKPYVCKIPGCTK
RYTDPSSLRKHVKTVHGPEAHVTKKQRSDLPPSRPMPPKENGENDTGRGTGEKMDSASRG
LEDYLQVKSIKTENSVVYQSSPGGQSSCSSEPSPLGSATYHDSGVEMALHSGGGSVGDLT
GLDESPGPFLDPSTSCLSSGESGLGVGLHLRQRLAPSYIHRLEHLKKEKLKTVRDSCQWA
DHHPAPPVQNTKLPPISASGYLLESSGTGDGPGSLPGLSPGKTTFLNQLDHLMERRDSTA
STASSAYVSRRSSGISPCYSSRRSSDASTFSGHRNNISSTGSYDPISTDLSRRSSEASQC
GGGGGLPGLLSLTPAQHYHLKAKYAAATGGAPPTPLPCMEVMSLKTCVARYGNSPTGGSP
SGNYALDGVTSGGVPRRCGAGIGGYDARSMMPHEVPSSIPRRASDPVPRRPSLCPPSHQP
RVQRYNSVGDMQSLHPQAFQANQAQSAAEQRHLALQGRHPRSDGSLQRYPYCPRPPSISE
NIAMETLAGDVVRGRNNAGDEVMSLPDDVIHFVAFQDGSGECIAGYNRSFHGNAINPNQQ
QQAFYNQKKAPVVDSDMNMNLLSPPQTQTVPLSCALNPSQQNQPFLSSPRLSKSCMPVQW
NEVSSGTVEAPHDQTKRQQFCRGNANLAVVQQKQNFGSFKNENLNSNRHISQVAHNLSHA
ARQGRHIQHQNTEARLSHDPQHRLHANANLNEPVGLEYGFEQILGPSVANGNANQSSSCN
NVTDGGALGMLTGHTIDVQNHRLRSQSGEGQTFLDGSVNSTQTISRQQSYKMATQVLHPL
QNGGQPLLQPRPPAESKSRSRQHSGSTTTLQQNLTGHRTDSGFMFYTGQIHVFEPNGNVN
GQTLTSSVADVPQCPLDSGETATTSPGITNQVSSTVDLSNRNGAEQPQIDFDTMLDDGDH
SSLMSGTISPSILQSLSQTSSRLTTPRNSVTLPSLPIPAGGSNMAIGDMSSLLTALAEES
KFLNMMS
NT seq 4524 nt   +upstreamnt  +downstreamnt
atgtccagaatggagacatcagcctcgacggccacagagaagaaagaactgaaaggcgct
ggtctggatggaaatggctttgcggacctccctaagaaaccctcaccttcagccgtcacc
agagcccctcaccacatgttcccgacgttccacacgcccatcccgattgacatgcgtcac
cacgagggaaggtaccactatgaaccgcattctctacatgccatgcatggacctgcactc
ggtggtagcccggtcatctccgacggcatctccctgatccgcctctctccccacgcaccc
gggacgggggagtcccccttcagccagcctcacccgtacgtcagccaccacatggagcag
tacctgaggtccatgcacagcagccccagcctgtccatgatctcagcggcccgcggactc
agccccgccgagttggctcatgaacacttgaaggagcggggtctgttcgggttgccccct
ccccctcccggagccaacccggctgattactaccacctgatggccggccatcggaatccc
tacggagacctgttgatgcagggcgcaggggcctcccacctgccggactacatcaccccg
gtggacgtgtcacggttctccagcccccgtttgacccccaggctgaacagaaagcgagca
ttgtccatctctcctctgtcggacgccagcatcgacctccagaccatgatccgcacctcg
cccaactctctggtggcctacatcaacaactcgcgctccagctctgcagccagcagctcc
tacgggcacctgtctgttggaggcatcagtccctccttcacgttcccacacgccatcaac
cccatagcctaccagcagctcctgtcccagcagagaggcctgagtgcgttcggccacacc
cctcctctcatccagcccccgccctccttctctagtcgacagtcagccttgggcctctcc
tctgtgcccccttcttcacatgaccccaacctggactcacagtcaaagaatccatgtgga
gactcagcagtcagtagcaccgttaaccctatgatcaccaaaaggtcaaaggtaaagatg
gaggtggagtgcccaaggccgctgtcaccatgttctccgcagaatcacctgggcagaaca
ctggacctgaaggaggacctggataaagacgagtgcaaacatgaaccagagatggagatg
gtgtatgagaccaactgccactgggagggatgctccagggagtacgacacacaggaacag
ctggtccaccacatcaataacgaccacatccacggggagaagaaggagtttgtgtgtcgc
tgggaggagtgcacgagggagcagaagcccttcaaggcccagtacatgctggtggttcac
atgaggagacacaccggggaaaaaccacacaaatgtacttttgagggctgctgtaaggct
tactcccgcctggagaacctgaagacacacctgcgctcccacacgggcgagaagccgtac
gtgtgcgatcacgagggatgcaacaaagccttctccaacgcctcggacagagccaagcac
cagaaccgcacacactccaacgagaaaccgtacgtgtgtaaaatcccaggatgtacgaaa
cgctacacggacccgagttccctcaggaagcatgtgaagacagtccatggaccagaggcc
catgtcacaaagaaacagcgcagcgaccttccgcccagcagacccatgccacccaaagag
aatggtgagaatgacacaggacgtggcacgggggagaagatggacagcgcctccaggggc
ctggaggactacttgcaagtcaagtctattaagacagagaactctgtggtgtatcagtcc
agccctggtggtcagtcatcatgcagcagcgaaccgtcgccacttggcagtgccacctac
catgacagtggagtagagatggcccttcacagtggcgggggcagtgtgggggacctgacc
gggctcgacgaatccccggggcccttcttggacccctccacctcgtgcctctcgtctgga
gagtcggggctcggggtgggcctccacctgcggcagcggctggctcccagctacatccac
agactagagcacctgaagaaggagaaactgaagacggtgagggactcctgccagtgggcc
gaccatcatcctgctcctccagtccagaacaccaagctaccgcccatatcagccagcggg
taccttctggagagttcaggtacaggtgatgggcccggatcgctgcccggcctcagtccc
ggtaaaaccaccttcctgaaccagctggaccatctgatggagcgccgggacagcaccgcc
agcaccgcctcctccgcctacgtcagccgccgctccagcggcatctcgccctgctactcc
agccgccgctccagcgacgcctccacgttcagcggccaccgcaacaacatcagctccacg
ggctcctacgaccccatctccacggacctgtcccggaggtccagcgaggccagtcagtgt
ggaggtggtggaggcctgcccggtcttctcagcctcaccccagcccagcactaccacctc
aaggctaaatacgcggcggccacggggggcgcccctccgacgcctctaccctgcatggag
gtgatgagtctgaagacttgcgtggcccgttatgggaactctccgacggggggctcaccg
tccggcaactacgccttggacggcgtcacctccggtggcgttccgaggcgctgcggggct
ggcattggagggtatgatgcccgcagcatgatgccccacgaggtgccgtccagcatcccc
cgtcgggccagcgatcccgtcccgcgccgtccgtccctgtgcccgccgtcccatcagccc
cgggtgcagcggtacaacagcgtgggcgacatgcagagcctccatccccaggccttccag
gccaaccaggcccagtccgcggccgaacagcgccacctggccctgcagggccgccacccg
cgctccgacggcagcctgcagcgctacccgtactgcccccgcccgcccagcatctccgag
aacattgccatggagaccctggcaggcgacgtggtcagaggtcgcaacaacgccggggac
gaggtgatgtcacttcccgatgacgtcattcactttgttgcgtttcaggacggatcagga
gagtgtatcgccgggtacaacagaagtttccacggaaatgcaataaaccctaaccaacag
cagcaggcgttttacaaccagaaaaaggcacctgtggtggactccgatatgaatatgaac
ctcttgtcgccaccacagacacaaactgtgcccctgtcctgtgccctgaaccccagccag
cagaaccagcctttcctctcctcacccagacttagtaagagctgcatgccagtccagtgg
aatgaggtcagctctgggacagtggaagcccctcacgaccaaaccaaacgacagcaattc
tgtcgagggaatgcaaacctcgctgtggtccaacagaaacagaactttggctcgttcaag
aatgagaatctgaactccaaccgacacatttcacaggtggcccacaacctgtctcacgca
gcccggcaaggaagacacatacagcaccaaaacacagaggcaaggctgagtcatgacccg
caacacaggctacatgctaacgctaacctgaatgaaccagtgggccttgagtatgggttt
gaacagattctggggcctagtgttgctaacggtaatgctaaccagagttcctcctgcaat
aacgtgacggatggtggcgctctgggtatgttgacagggcacaccatagatgtgcagaac
caccggctgaggtcacaatcaggggaaggtcagacgtttttggacggcagtgtgaattct
acacagacaatctcacgtcaacagagctataaaatggccacccaggtcctgcatcctctc
caaaatggaggtcaaccgctccttcagccaagaccgcccgcagaatcaaagtctcgaagc
agacagcattcagggtcaacgacaacgctgcaacaaaacctgactggccaccgtacggac
agcggtttcatgttctacactggacagatacacgtctttgagcccaacggaaacgtcaac
gggcagacgctgacatcatcggtagcggacgtccctcagtgtccattggacagcggagag
actgccacgacctctccgggaataaccaatcaggtctccagtacggtggacttatccaat
aggaatggagcggagcagccccagattgactttgacaccatgctggacgacggggaccac
tccagcctgatgtcgggcaccatcagccccagtatcctccagagtctgtcccagacctcc
tccaggctcaccaccccacggaactctgtcactctgccctccctgcccatcccagcaggg
ggcagcaacatggccattggagatatgagctccttgctcacagcgctggccgaagagagc
aagttcctcaacatgatgtcataa

KEGG   Esox lucius (northern pike): 105024675
Entry
105024675         CDS       T04894                                 

Gene name
gli2
Definition
(RefSeq) zinc finger protein GLI2
  KO
K16798  zinc finger protein GLI2
Organism
els  Esox lucius (northern pike)
Pathway
els04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    105024675 (gli2)
Transcription factors [BR:els03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 GLI-like
    105024675 (gli2)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 FOXP-CC
Other DBs
NCBI-GeneID: 105024675
NCBI-ProteinID: XP_010893057
UniProt: A0A3P8ZPF1
LinkDB
AA seq 1512 aa
MEASAPTATEKNKHKGSGMDGSSFSDLTKKSSPTTVTRGPHPLFPTFHTPIPIDMRHHEG
RYHYEPHPLHAMHGPPGLAGSPVISDGISLIRLSPHAAGTGESPFSPPHPYVNHHMEQYL
RSMHSSPTLSMISAARGLSPADVTHEHLKERGLFSLPPPPPGANPTEYYHLMASGRSTYG
DLLMQSGAAAAHLPDYISPVDVSRFSSPRLTPRLSRKRALSISPLSDASIDLQTMIRTSP
NSLVAYINNSRSSSAASSSYGHLSVSGISPSFTFPHTINPMAYQQLLNQQRGLSAFGHTP
PLIQPSPSFSARQHAHALAASTLNTAYNSSSSDSNQNAGGDPAVSSTVNPMITKRHKVKT
EAEGPRPISPCSQEHTLDLSEELDKDECKQEPEVVYETNCHWDGCTKEYDTQDQLVHHIN
NDHIHGEKKEFVCHWDECSREQKPFKAQYMLVVHMRRHTGEKPHKCTFEGCCKAYSRLEN
LKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRTHSNEKPYICKIPGCTKRYTDPS
SLRKHVKTVHGPEAHVTKKQRGDVPPRGPPKGNGENEANAKHSGRGLDGKTEANSTTRGE
EDCLQVKSIKTEKMMTYQSSPGGQSSCSSEPSPLGSAHNNDSGVEMALHSGGSFGDLSAL
DDLPMVDSSTLSPGNSAGVGLGLRKGGGVTIKLENIKKERLKNVRDSCPWANTAPQAPLV
RNINTKLPPIPAVGSLLENSNMIGPLGPCPPQRFGDLSSCEVTMLNQLNKQGRRDSNTST
ASSAYISRRSSGISPCYSSRRSSEASQFGGRHNNISSADSYDPISTDLSRRSSEASHCGG
GGGNLPSLLSLTPAQHYRLKAKYAAATGGAPPTPLPNMERMSLRTRMALYGEHSQERESS
AHSHLFHPGTGAVPRRCSDIGYGNRSVMPHEVPGNLPRRASDPICRPAPDPLSQPRGERY
NSMNGMILNAAMPPFSADRRGLASQGYTRSDGSLHRHPFVPRPPSISENAVMETMAVDGM
DHVGDEDLMLPDDVVQYLRSQNNDPGQSVGPADYSGGQSQGFQVQSLGSSQYAQQQQHFY
GQRRMALADTNTPLSGSGHPPLPPYQMSSVSGSLQQQFPAPPSMNNKNNMPVQWNEVSSG
TVDATATSRLTKQNLLRNNNLAVIQQRQNFGPFQGAASGNGNHQVMPMSQNVALHGYAPR
CNAQRINPAQLHQQQRLPCGMSYTEQMSPQQGYSQEIAPIPNSADGVVRPDYGSVDPLSN
RAMGAHSNPETQNYRSRTQVEIYPLHVNQVDQLDNSISTQPLAVLNGNRSGMQPRPPPEP
KSMSGRQHSGSGSSVQQNIFPQSDFNPNNTSEASPKRPVGLSAHNARGNAPMFYAGQIHM
FEPNSDASFISPMSPCAGQAPVGATVALASPGVNQVTSTVDSSGSGATSGIEHAQIDFDA
MLDDGDHSSLMSGTLSPGLLTSLSQNSSRLTTPRNSVTLASVPAGIGNMAIGDMSSMLTA
LAEESKFLNMMS
NT seq 4539 nt   +upstreamnt  +downstreamnt
atggaggcctctgctccgacagccaccgagaagaacaagcataagggatcaggtatggat
ggaagcagcttctcagacctgacgaagaaatcctctccaactacggtgaccagaggtcct
caccctctcttccccacgttccacacaccgatcccaatagacatgcgtcaccatgagggg
cggtaccattacgagccacaccccctccacgccatgcatggacctccgggcctagcgggc
agcccggttatctcggacggcatctccctgatccgtctgtcccctcatgccgccgggacg
ggggagtcgccgttcagcccccctcacccttacgtcaaccaccacatggagcagtacctg
aggtccatgcacagcagccccaccctgtccatgatctccgccgcccgcggactcagccct
gcagacgttacccatgagcacctgaaggagcgcggcctgttcagccttcccccccctcct
ccgggagccaaccccacagagtactaccacctcatggccagtggcaggagcacctacggg
gacctcctcatgcagagcggcgcggcggcggcacacctgcccgactacatcagcccagta
gacgtgtcacggttctccagcccaagactcacacccaggctgagccggaagagagccctg
tccatctcccctctctcggacgccagcatcgacctccagaccatgatccgcacctcgccc
aactccctggtggcctacatcaacaactcgcgctccagctctgcagccagcagctcctac
ggacacctgtcggtcagcggtatcagtccctcctttaccttcccccacaccatcaacccc
atggcctaccagcagctgcttaaccagcagagaggcctgagtgcgttcggccacacccct
cccctcattcagccttcaccctccttctcggcccggcagcacgcgcacgccctggccgcc
tcaaccctcaacactgcctacaactcatccagctccgattccaaccagaatgctggtggt
gaccctgcggtgagcagcacagtcaaccccatgatcaccaagagacacaaggtcaagaca
gaagcagagggtcctcggcccatttcgccatgctctcaggagcacaccctggatctgagc
gaggagctggacaaggacgagtgtaagcaggagccggaggtggtctacgagaccaactgc
cactgggacggctgcaccaaggagtacgacacccaggatcagctggttcaccacatcaac
aacgaccatatccacggggagaagaaggagtttgtgtgtcactgggacgaatgttctcgg
gagcagaagccgttcaaggctcagtacatgctggtggtccacatgaggagacacacaggg
gagaagccacataaatgcacatttgaaggatgttgtaaggcctattcccgcctggagaac
ctgaagactcacctgaggtctcacacgggggagaagccgtacgtctgtgaacacgaaggc
tgcaacaaagccttctctaatgcctcagacagagccaagcaccagaaccgcacacactcc
aatgagaaaccgtacatctgtaagatccccgggtgcaccaagcgctacactgaccccagc
tctctcaggaagcacgtgaagacagtccacggacccgaggcccacgtcaccaagaaacaa
cgcggcgatgtgccccccaggggccctcccaaggggaacggagaaaatgaggccaacgcc
aagcacagtggaagagggctggacgggaagacggaagccaacagcacaaccagaggagag
gaggactgcctgcaggtcaagtctatcaagacagagaagatgatgacgtatcagtccagc
cctggcggtcagtcgtcatgtagcagtgagccgtcgccacttggaagtgcccacaacaat
gacagtggagtagagatggccctgcacagcgggggaagcttcggggacctgagcgcactg
gacgaccttcccatggtggactcttccaccctctccccaggaaactcggccggggtgggg
cttgggctccgcaaagggggaggggtcaccatcaagctggagaacatcaagaaggagagg
ctgaagaatgtgagggactcatgtccatgggccaacaccgcgcctcaggcacctctggtc
cggaacattaacaccaagctgcctcccattccagctgttggttccctgctggagaactcc
aatatgatcggcccactggggccctgccctccccagcgttttggtgacctgtcatcttgc
gaggtgaccatgctgaaccagctaaataagcaggggcgccgggacagcaacaccagcact
gccagctcagcctacatcagccggcgctcctccggcatctctccctgctactccagccgc
cgctcctccgaagcctcacagttcggcggccgccacaataacatcagctcggccgactcg
tacgaccccatctccacggacctgtcgcggcgatccagcgaggccagccattgcggaggt
ggcgggggcaacctgcccagcctcctcagtctcaccccggcccagcactaccgtctcaag
gccaaatacgcggcggcaaccgggggcgctcccccaacacccctgcccaacatggagcgt
atgagcctcaggaccaggatggccctgtacggagaacactcccaggagagggaaagctcc
gcccactcccacctgttccaccccggcaccggagcggtacctaggcgctgcagtgacatc
ggctacggcaaccgcagcgtgatgccccacgaggtccccgggaaccttccccggcgagcc
agcgaccccatctgcaggcccgccccggacccgctgtcccaaccgcggggtgagcgctac
aacagcatgaacggtatgattttgaacgccgcaatgcctcccttctccgccgaccgccgt
ggcctggcctcgcagggctacacgcgctccgacggaagcctccaccgccaccctttcgtc
ccccggccccccagcatatcggagaacgccgtgatggagaccatggccgtggacgggatg
gaccacgtaggggacgaggacctgatgctgcccgatgacgtggtgcagtacctcaggtcg
cagaacaacgaccctggccaatcagtgggccctgccgactactccggcggccagtcacaa
ggcttccaagtccagagcttaggttcctcccagtatgctcagcagcagcagcatttctat
ggacagaggaggatggctttggcggacaccaacacacccctctctgggtcaggccaccct
cccctgcccccctaccagatgagctctgtttctgggtcactgcagcagcagttcccagcc
cctcccagcatgaacaacaagaacaacatgccagtccagtggaacgaagttagctcaggg
actgtggacgccacagctacctctcggctaaccaaacagaacctcctcagaaacaataac
ctggcagtgatccagcagagacagaacttcggtcccttccaaggggccgcttccggtaac
ggcaaccaccaagtgatgccaatgagtcagaatgtggcgttacacggctacgccccgaga
tgcaacgcccagaggatcaaccccgcccagctacaccagcaacagaggctgccgtgtggc
atgagctacactgagcagatgagtccccagcaaggatacagccaagaaatcgcccccatc
cctaactccgccgatggcgtcgtacgacccgactacggcagcgtggacccgctcagtaac
agagcgatgggagcgcacagcaatcccgaaacgcagaactacaggtcaagaactcaggtt
gaaatctatccccttcacgtcaatcaggttgaccagctggacaacagtatttcgactcag
ccattggccgtcctcaatgggaacagatccgggatgcagcccaggcctcccccggagcct
aaatctatgagcggtagacagcactcagggtccggaagcagcgtgcagcagaacattttc
cctcagtctgacttcaatcccaacaacacatccgaggccagtcccaagaggccagtgggc
ttgtcagcccataacgccagaggtaacgctccaatgttctatgccggccagatccacatg
tttgagcccaacagcgacgcaagcttcatctcccccatgtccccctgcgcaggccaggct
ccagtaggcgctacggtcgcattggcgtccccaggggtcaaccaggtcaccagcactgta
gactcatccggctctggagcgacctctggcatagaacacgcccagattgacttcgacgcc
atgttggatgacggggaccactccagcctgatgtcagggacccttagccccggactcctg
accagcttgtcccaaaattcctccaggctgaccacccctcgtaactcggtgaccctggcc
tctgtgccggcaggcatcggtaacatggccattggagatatgagttcaatgttgaccgcc
ctcgctgaggagagcaagttcctcaacatgatgagctaa

KEGG   Esox lucius (northern pike): 105027597
Entry
105027597         CDS       T04894                                 

Gene name
gli3
Definition
(RefSeq) transcriptional activator GLI3 isoform X2
  KO
K06230  zinc finger protein GLI3
Organism
els  Esox lucius (northern pike)
Pathway
els04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    105027597 (gli3)
Transcription factors [BR:els03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 GLI-like
    105027597 (gli3)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 FOXP-CC zf-C2H2_4 zf-C2H2_aberr
Other DBs
NCBI-GeneID: 105027597
NCBI-ProteinID: XP_010898055
LinkDB
AA seq 1646 aa
METQSQASSAAEKKKRVETIVATKGSSARADVSEKAVASSTTSNEDERSGTPYHPHHHHH
RERRNAISTQAPTPGAPGSKLGEEPSTSTEERPSLVKKELHSSLPHLSDHALPYRGTLFA
MDPRNGYIDSHYPPPQFFPTFHPPVPIDDRHAQGRYIYEPSPVPPLHVPPSLAGSPAFSD
ISLIRISPHRNPSVGAESPFNPPHPYINPYMDYIRSLHSSPSLSMISAARGLSPADAPHT
GLTTTEYYHQMALLAGHRSPYTDLLPSVASTAGATSSALHMEYLQAMESSRFPSPRLTAR
PSRKRTLPISPLSEHSFDLQTMIRTSPNSLVTILNNSRSSSSASGSYGHLSAGAISPALS
FAYPPTPVALQMHQQLLGRQPGMVGSAFGHSPPLIHPSPAFATQRPIPGIPPPGLAPSER
SVISNDSSQTKPTSESAVSSTGDPMHHKRSKIKPDEELPSPEADHPDGMTLVKEEGDKDE
SKQEPEVVYETNCHWESCHREYDTQEQLVHHINNDHIHGEKKEFVCRWEECSREQKPFKA
QYMLVVHMRRHTGEKPHRCTFEGCPKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSN
ASDRAKHQNRTHSNEKPYVCKIPGCTKRYTDPSSLRKHVKTVHGPEAHVTKKQRGDAYPR
PPPQPREGGNGQGRSPGQLGAYADQREYNHTTSKQDECLQVKSIKTEKPMTSQPSPGSQS
TCSSDQSPISAYPGRGVQLAVRGGGVGPSEGLGEEDGELEDEEEDEEDEEGLGACDAPVM
DSTVSTATAATLALQARRNIGRPMRWMEHMKMERLKQVNGGGAPRLGSLSPTPPPKGPTV
LPVILGKGPCLGRLAHPQPPPRPELGSTELTVLSLLRGIERHDRRDSSGSATSSAYLSSS
RRSSGISPCFSSRRSSQTSQSEATNTPGHHRRHHNLSSTDSYDPISTDASRRSSEASQCG
GAGGGVFVSGGWAGIGGGSKGMLNLTPAQHYHLKAKYAAATGGPPPTPLPNMEHISLKTR
MAMMVEGQDGGGSNHALPPLVRPRRCSDGSTTNGYGVHSGSRDYRRRILYPGEGPGNGSD
RRASDPVRTHTQNAHSEFFGLPQVQRFSSLNDIHPLPPLQHPTAEGRSFSLQNYTRSEGN
IQRGSLHSPCPPSIMEHAALEALAMEQEGTLSLGDEDMLPDDLVQYLRSQDQTGSYNNNL
ENHGAGENGHLSGGELQDQGPVLDQCFLSLRQSQGLEQESPSKDGMPIQWNEVSSGSAER
SPQRQGQAQQRCSRWATSEQQQATAGSRFGRFGNMVVQQHQPFTRDFQIQHCTQQGVGHL
QLQPQCRVNGDVKLESTTHSCMEMRGNGHHPLNAFLRPDFSQISVGPLPQGYGQQQYQNQ
THGTSRQTGNNLLLSRVSMDSLSQAPALHHPQAQALHHPQAPALHLQHTNSSYRHPARTP
QFTEHQQQNTNNECHANLTQQNLAQQNLRNQESHCSLAHQVSGLKLETPDQGYLDQRFDP
GDTKAPSFSPPEEQCLLENMTEQVGQDSAPASLLSPGADQVTSTVDSGACRSADVLDDVV
ALDFGAMLEDVGLGFDQGSLVSGVISPSIFQGLSRTSSRLTTPQASATFHSANGMVPSNL
SNMAIGDMSSLLTTLAEESKFLAIMQ
NT seq 4941 nt   +upstreamnt  +downstreamnt
atggaaacccagtcccaggccagttctgccgctgagaagaaaaagagggtggagacaatc
gtggcgaccaagggttcgtcggcgcgtgccgacgtcagcgagaaagccgtggcctcgagc
acaacgtccaacgaggatgagagatcaggcacgccataccacccccaccatcaccatcac
cgcgagagacgtaatgccatcagtacccaggcccccacgcccggcgcccctggcagtaag
ctgggcgaggagccgtccacctccacggaagagcggccctcccttgtgaagaaggagctg
cacagttcgctgccgcacctgtcggaccatgcgctgccctaccgcggcacactgtttgcc
atggatccgcgcaatggatacatagactcccactacccaccgccacagttcttccccacc
tttcatcccccggttcccatcgatgacagacacgcccagggacgatacatctacgagccg
tccccagttcccccgttacacgtgcctccctcgctggccggaagtccggcgttctcggac
atctccctcatccggatatcgccccaccggaacccctcggtgggagcagagtctcccttt
aaccctccgcacccctacattaacccctacatggactacatacgctcgcttcactccagc
ccctccctctccatgatctctgcagccaggggtctcagccctgcagacgcccctcataca
ggcctgaccacaacagagtactaccatcaaatggctctcctggcgggccaccgcagccct
tacacggacctcctcccctctgttgcatccacggccggagccaccagcagcgccctgcac
atggagtatctccaggccatggagagctctcggttccccagccccaggctgacagcgaga
cccagtagaaagcggaccctgcccatctccccactgtcggagcacagcttcgacctgcag
accatgatccgcacctcgcccaactccctggtcaccatcctcaacaactcccgctcaagt
tcctccgccagcggttcctacggacacctttccgctggggccatcagcccggcgttgagt
tttgcctaccccccgacccctgtggctctccagatgcatcagcagctgcttggccggcaa
ccggggatggtgggctccgcatttggccacagtccgccccttatccacccctccccggcg
ttcgccacccagcggcccatccccggcatccctcctcctgggctcgcccccagtgagcgc
tccgtcatctccaacgactcctcacagacaaagcctaccagtgagtcagcagtgagcagc
acaggggatcccatgcaccacaagcgctccaagatcaaaccggacgaggagctacccagc
ccagaagccgaccatccagatgggatgactcttgtgaaggaggaaggggacaaggatgag
agcaagcaggagccagaggtggtgtacgaaaccaactgccactgggagagctgccatcgg
gagtatgacacgcaggaacagctagtgcatcacatcaacaatgaccacattcacggggag
aaaaaggagtttgtgtgtcgctgggaggagtgttcacgggagcagaagcccttcaaggcc
cagtacatgctggtggtccacatgaggagacacacaggcgagaaacctcaccggtgcacg
tttgagggctgtcccaaggcctactctcgtttggagaacttaaagacccacctgcgctct
cacactggagagaagccttacgtttgtgaacacgagggctgcaacaaagccttttccaac
gcctctgacagagccaagcaccagaaccgcacacactccaatgagaaaccttacgtgtgc
aagatccccggctgcactaagcgctacacggaccccagctccctacgcaagcacgttaag
acagtgcatgggcctgaggcacatgttactaagaagcagcgtggcgacgcatacccacgc
cccccgccgcagccccgggaggggggcaatggacaggggaggtcgccggggcagctggga
gcttatgcagaccaaagggagtacaaccacactacctcgaaacaggatgaatgtctgcag
gtcaaatccatcaagacggagaaacccatgacgtctcagccaagccctggcagtcagtct
acatgcagcagtgaccagtcccccatcagcgcctatccaggccgtggagtccagcttgct
gtgaggggagggggggtgggaccgagcgaggggctgggagaggaggacggagagctggag
gacgaggaggaggatgaggaagatgaggaaggtctgggcgcctgcgatgcccccgtcatg
gactccacagtgtcaacggccactgcggccaccctcgcgctgcaggcgaggaggaacatc
ggccggcccatgaggtggatggagcacatgaagatggagaggctaaagcaggtgaacgga
ggaggggcccccaggttgggctccttgtcccccacgccgccccccaagggcccaaccgtg
ctgcctgtcatcttagggaagggtccatgcctggggaggttagcccatccccagcctccc
cctcgtccggagctgggcagcacagagctgacggtcctcagtctactccgcggcattgag
cgccatgaccggcgagacagcagcggcagcgccactagctcagcctacctgagcagcagc
cgtcgatcctctggcatctcgccatgcttctcatcacggcgctccagccagacctcccag
agcgaagcgaccaacaccccgggtcaccaccgccgccaccacaaccttagctccactgac
tcctacgaccccatctcaacggatgcatcgcgccgctctagtgaggccagtcagtgcggc
ggagccggtgggggcgtatttgtgagtggagggtgggcgggaatcggcggaggctccaag
gggatgctcaatcttacgccggcacagcactaccacctcaaggcaaagtacgctgctgcc
acaggcggcccgcccccaacaccgctgcccaacatggagcacattagcctgaagacccgc
atggccatgatggtggagggccaggacggcggtgggagcaaccatgcactgcccccgctg
gtcaggccgcgtcgctgcagcgacggaagcaccaccaacggttatggggtccacagcgga
agccgagattaccgccgacggatcctttatccgggtgaaggcccagggaatggctcggac
cggagagccagtgaccccgtgcgcacccacactcagaatgctcactctgagttcttcggg
cttccccaagtccaacgcttcagcagcctcaatgacatccaccctctgcccccactccag
catcctacagcagagggtcgcagcttcagcctgcagaactacacgcgctctgagggtaat
atccagcggggaagcctccactctccctgccccccaagtatcatggagcatgcagcccta
gaggctctggcaatggaacaagagggtaccctgtcgctgggcgatgaggacatgctgccg
gacgaccttgtacagtacctccgctcccaggaccagacgggctcctataacaataatctg
gagaatcacggagctggggaaaacggacacctttctgggggggagttgcaagaccagggc
ccggtgttggaccagtgcttccttagcctccggcagtcccagggacttgagcaagaaagc
cccagtaaagacggcatgcccattcagtggaatgaagtgagctccggaagcgctgagagg
tccccacagaggcagggccaggcacagcagaggtgtagccgctgggccacgtcagagcag
caacaagcaacagctggctctcggtttggacggtttgggaacatggtggtgcagcagcat
caacccttcaccagagacttccagatccaacactgcacccagcaaggtgttggtcatctc
caacttcagccacaatgcagagtcaatggcgacgtaaaattagagtcgaccacccactcc
tgcatggagatgagagggaatggccatcaccctttgaatgcttttttgcggccagacttc
tcccagatctctgtagggcctttgccccagggctatggccagcagcagtaccagaaccag
actcatggaacctcccgacagaccggaaacaacctgctccttagccgggtctccatggac
agcctctcccaggccccggcgctccaccaccctcaggcccaggcactccaccaccctcag
gccccggcgctccacctgcagcataccaatagcagctacagacacccggctagaacgcca
cagttcacagagcatcaacaacaaaacaccaacaacgaatgccatgccaacctcacccag
cagaaccttgcccaacagaacctgaggaaccaagaaagtcactgttccctggcccaccag
gtgtccggcctgaaactggagactcctgaccaggggtacctggaccagcgctttgaccct
ggagataccaaggcaccttccttctcacccccggaggagcagtgtctgcttgagaacatg
acggagcaggttgggcaggactcggccccagcctctcttctctccccgggtgccgaccag
gtgaccagcacagtagacagtggtgcatgcaggtcagctgatgtgctagacgacgtagtg
gcactggatttcggggccatgctggaggacgtggggctaggctttgaccaggggagtctg
gtgtcgggggtgattagcccttccatctttcagggtctgtcacggacctcgtcccgtctc
accaccccccaggcgtccgccaccttccatagcgcaaacggaatggttccctccaacctc
agtaacatggccattggagacatgagctccctgctcacaaccctcgcagaagagagtaag
ttcctggccatcatgcagtaa

KEGG   Esox lucius (northern pike): 105028311
Entry
105028311         CDS       T04894                                 

Gene name
gli1
Definition
(RefSeq) LOW QUALITY PROTEIN: zinc finger protein GLI1
  KO
K16797  zinc finger protein GLI1
Organism
els  Esox lucius (northern pike)
Pathway
els04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    105028311 (gli1)
Transcription factors [BR:els03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 GLI-like
    105028311 (gli1)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 FOXP-CC
Other DBs
NCBI-GeneID: 105028311
NCBI-ProteinID: XP_010899258
LinkDB
AA seq 1522 aa
MPVDMQPHQGLCHYDSTTNHPSRGLTPSGRSPYSDVSSMRAQLHNGQLQECRNMYSPMTP
NPMTPNPRVNPNSGVNPMDQFMRPPLVPPPHSMMGHRNMNQSSEGGISTPYCHNNLMSSH
HGFPHGQGSDHIGDGSRFSTPRSMLKLSKKRALSISPLSDASVDLQTVIRTSPNSLVAFV
NSRCGPGGASSYGHLSVGSMSPSLGYSNYQSRQQSSMYGGHTPCHAPPPRLPPHNPRLHT
PKHGHLKTEPVLGSVMDGINIKSLDERSDGDVASPSSIGTQDPLMGLLDGRDDLDKEEKP
EPEAIYETNCHWESCSKEFDTQEQLVHHINNEHIHGEKKEFVCHWQECSREQRPFKAQYM
LVVHMRRHTGEKPHRCTFEGCNKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASD
RAKHQNRTHSNEKPYVCKILGCTKRYTDPSSLRKHVKTVHGPEAHITKKHRGDTGPRPPG
SSLTPSGQSGELLLEKEEAGRRGDCKLLVPESALKSQPSPGGQSSCSSERSPLGSANNND
SGVEMNLNAAGSLEDLTALEDGXGWGGGGEATRGGPGTAGMGGMSAQALKRLENLKIDKL
KQIRRPTPPGHCCGTNKLPALSGGQGEMMGGMCAPSPLLSNRRVMELSNHELGGGPSGMS
CPINDRRGSGTSSLSSAYTVSRRSSMVSPYLSSRRSSEVSQLGGVGNGGGFLGPDQGGGD
PLSPETIRQGGPCHGVGGGGGLPGLPSLTPAQQYSLKAKYAAATGGPPPTPLPNMEQGTG
TTGRRGFLSDYQGQPIPAFLQQGGPRRHSANTGDYGTGVIYPHQAPGNATRRASDPVRSS
GDQQALPKVQRFNSLNNVAMMGRRNALHHCGSDANIARHMYSPRPPSITENVMMEAMAID
SHGGTADARDHSMMLPQGERGFLGYQSHHMGGPSSQLSPNHASLGCPEQGYQTQGQMSMH
GGLYQVSSRGLGQAQVGQGGPSHPDGMSNTLLQQTEYSLSTCQLSPSGPNYSNGPVGGAG
PWGEISQAQTPHVATQTGMQYQDPASMQGPTQGLYSNQPGLYSQGPAGEHKVNIKPEQQQ
YHPALANPDACQKHLHQQKPHPGQTPTAVGHVSPQSGYPQPSQTPQGMMRTANPSCDFLR
GGMDNQNQAPMQQGSFPQSGGISLGSTGLGPGGRSQTPMMQVKEMMVRNYVQSQQALMWG
QEPEQRPVGTDGKPLPLSDSMDVTAQQVAVMQQQQSNHQHQQNLYTNPGPSYPGYAINQN
LMSPPAHGPSSTSSIPPKDLVMMGLPAGPAPCYSQDMVVPVVPRPPQSRKPLSRQNSLQS
QGGGGYLGSPPHLSPVHSTSSPRRVVRLPPVPVRQTPHQEMFSTSNNNNNVYYSGQISMQ
HPDIDKQQIQQINHPLQDPTQTRPCLNQHRPHMVTHMDHQGNKSASLAYPNESTPISNAL
ENLDLDNAQIDFTSIIDDPDPSSFSPVNPPLHGGSSQTSSRLTTPQTSITLPPTGLSNMA
VGDMTSMLTSLAGENKYLNTLS
NT seq 4569 nt   +upstreamnt  +downstreamnt
atgccagtggacatgcaacctcatcaggggctgtgccactatgactctacaaccaaccac
ccgtccagagggctcactccatcaggtagatccccctacagtgatgtgtcgtcaatgcgc
gctcagctccacaacggccagcttcaggaatgcaggaacatgtacagccccatgacccct
aaccccatgacaccaaaccccagggtcaaccccaactccggggtcaacccaatggaccag
tttatgcgtccccctttggttcccccaccgcacagcatgatgggacatcgcaacatgaat
cagtcctccgaaggtgggattagcaccccctactgtcacaacaacctcatgtcttctcac
cacggtttcccccatggacagggatcagaccatataggagatggctcgcgcttctccaca
cctcgctccatgctgaagcttagcaagaagcgtgccttgtccatctctccactgtcggac
gccagcgtggatctccagacggtcattagaacctcgccgaactcgctggtggctttcgtg
aactcacgctgtggaccaggcggagccagctcctacggccatctgtctgtgggctccatg
agtccatccctaggatactctaactaccagtccaggcagcagagctccatgtatggagga
cacaccccctgccacgccccaccgccacggctgcccccccacaacccccgccttcacact
ccgaaacacggacacctaaagaccgagccagtgttgggtagtgtgatggatgggattaac
attaaaagtctggatgagaggtctgatggagatgttgctagtccttcctcgattggtaca
caggatccactcatgggtctccttgacggcagggatgacctagacaaggaggagaaaccg
gagccggaggcgatctacgagaccaactgccactgggagagctgcagcaaggagtttgac
acccaggaacagttagtgcatcacatcaacaacgagcacatccacggtgagaagaaggag
tttgtgtgccactggcaggagtgttcccgggagcagcggcccttcaaggcccagtacatg
ctggtggttcacatgcgaaggcacacaggggagaaaccacatcggtgcacttttgagggc
tgtaataaagcctactctcgtctggagaacctgaagacacacctgcggtcccacacgggg
gagaagccatacgtctgtgaacatgagggatgtaacaaagccttctccaacgcctcagac
agagccaagcaccagaaccgcacacactccaatgagaagccttatgtgtgtaagatcctt
ggatgtacgaaacgctacacagaccctagttctctgcggaagcatgtgaagacagtccac
ggccctgaggctcacatcaccaagaagcacagaggagacactgggccaaggccacctggc
tcttcactaacccctagtggacaatctggtgaactgctgctggagaaggaggaggctgga
agaagaggggactgtaaacttttggtgcctgaatctgctcttaagtctcagcctagtccg
ggcgggcagtcgtcctgcagcagtgaacgctctccacttggtagtgccaacaacaatgac
agtggtgtggagatgaacctgaacgccgctggcagtctggaggacctgactgctctggag
gacggtnggggctggggggggggaggcgaggcgaccagaggagggccaggcaccgccggg
atggggggcatgtcggctcaggccctaaagagactggagaacttgaagatagacaagctc
aaacagatcagacggcccactccacctggacactgctgtgggactaacaagctaccagca
ctctcaggcggacaaggtgagatgatgggagggatgtgtgctccctcgcccctcctctcc
aaccgccgtgtcatggaactgtccaatcacgagctgggaggcggaccctctggcatgtcc
tgtcctatcaacgaccggagggggagtggcactagcagcctaagttctgcatacacagtg
agccgtcggtcttccatggtctccccctacctctccagccggcgatcaagtgaggtctcc
cagttaggaggagtaggaaatggaggagggttcctaggtcctgaccagggaggaggtgac
cccctctcgcctgagactattcgccaaggggggccctgccatggtgttggaggcggagga
gggttgccaggtttgcctagtctaacacctgctcagcagtacagcttgaaagcaaaatat
gcagcagcaactggtggcccaccccctactccgcttcctaatatggaacaaggaacaggg
acaaccgggagacgaggtttcctcagcgactatcagggtcagccaatacctgcattcctg
cagcagggaggtccaaggagacacagtgccaacacgggggattatggcaccggggtcatc
tacccccaccaagccccaggaaatgccactcggcgtgccagcgaccctgttcgctccagc
ggagaccaacaggcccttcctaaggtgcaacgcttcaacagcttaaacaacgtggccatg
atgggacggaggaacgccctgcatcactgcgggtcggacgctaacatagcccgccacatg
tactcgccacggccacccagtatcacagagaacgtcatgatggaggcaatggcgattgac
tcccacgggggaaccgcggatgccagggaccacagcatgatgcttccccagggagagaga
ggcttccttggctaccagtcccaccacatgggaggtccctccagccaattatcacccaac
cacgccagcctgggatgcccagagcagggctaccagacccagggacagatgtccatgcac
ggtgggctctaccaggtctcttccagaggactgggtcaggcccaggtgggtcagggggga
cccagccaccccgacgggatgtccaacaccttgttacaacagacggagtacagtctcagt
acgtgccagcttagtccgtccggaccgaactactccaatggcccggttggcggcgcgggg
ccctggggggagataagtcaggcacagacccctcatgtagctactcagactgggatgcaa
tatcaggacccggcctccatgcagggcccgacgcagggtctctacagtaaccaaccgggg
ctgtacagccaagggcctgctggcgaacacaaggtgaacatcaaaccagagcagcagcag
taccacccggccctggccaatccggacgcctgccagaaacaccttcaccagcagaagcct
cacccagggcagacgcccacagccgtgggacacgtgtcgccccagagcggctacccccag
cctagtcaaaccccccaaggcatgatgaggaccgccaaccccagctgcgacttcctcaga
ggaggcatggacaaccaaaatcaggcccctatgcagcagggttccttcccccaaagcggt
ggcatcagccttgggtcgactgggttgggtcccgggggtcgctcccagacgcccatgatg
caggtgaaggagatgatggtgaggaactacgtgcagtcccagcaggctctgatgtggggt
caggagccggagcagaggccggtcggaacggatgggaaacctcttcctctgtcagacagc
atggacgtgacagcccaacaggtggccgtgatgcagcaacagcaaagcaatcaccaacac
caacagaacctctacaccaacccaggtccaagctaccccggctacgccatcaaccagaac
ctgatgagccccccagcgcatggccccagctcaacctcttccattccgcctaaagactta
gtcatgatgggcctgcctgcaggtccagccccctgctacagccaggacatggtggtcccc
gtggttcccagacccccacagtcccggaagcccctcagcaggcagaatagtcttcagtcc
caaggaggcggagggtacctgggtagtcctcctcacctcagccccgtccactccacctcg
agccccaggagagtggtccgtctacccccggtcccggtccgtcagacgcctcaccaagag
atgttctccacctcaaacaataacaacaacgtgtactactccggtcagatctccatgcag
caccctgacatagacaagcagcagatccagcagatcaaccaccctctccaggaccctacg
cagaccaggccctgcctcaaccagcaccggccgcacatggtgacccacatggaccatcag
ggtaataaatcggcatcccttgcataccccaatgagtccacaccaatttccaatgctctt
gagaacctagatctggacaacgcccagatagactttacctccatcatcgatgacccagat
ccctcgtcgttcagccccgtcaaccctcctctccacgggggttcgtctcagacctcttcc
cgcctcaccaccccccagacgtctatcaccctgccccccactgggctctccaacatggct
gtaggtgacatgacctccatgttgacctcgctagctggagagaacaagtaccttaataca
ctatcttag

DBGET integrated database retrieval system