KEGG   Esox lucius (northern pike): 105020266
Entry
105020266         CDS       T04894                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
els  Esox lucius (northern pike)
Pathway
els04012  ErbB signaling pathway
els04068  FoxO signaling pathway
els04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    105020266
   04068 FoxO signaling pathway
    105020266
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    105020266
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 105020266
NCBI-ProteinID: XP_010885452
LinkDB
AA seq 189 aa
MCNKMSNVRLSNGSPTLERVDACPTDNTKPSICRNLFGTGDPEERKRVCSLQIKEMAKNF
SDKWNYDFINDEPLPGGTYTWELVESPAEFYTRQPHKRVSPTENMYQNGNHDYRVGPSCP
TNESEVSTNTEMSERQTDGPISDNQARKRPSSPEPESPSKRLCSSEEVEVMSKSVQQTPS
KKDSRTHEH
NT seq 570 nt   +upstreamnt  +downstreamnt
atgtgcaacaaaatgtcaaatgttcgtctttcgaatgggagcccgacattggaaagggtg
gatgcctgtccgacggataacacgaagccctcgatttgcagaaatctattcggaacggga
gatcctgaagaacgtaaaagggtgtgttcgttgcaaatcaaagagatggcgaagaatttt
agcgataaatggaattatgatttcattaacgacgagccccttcccgggggtacatataca
tgggaactggtggaaagtccagctgaattttacaccagacagccccacaagcgagtcagt
cccactgaaaatatgtaccagaatgggaatcacgattacagggtcggaccgagctgtcct
acgaacgagtctgaggtctccacaaacaccgaaatgagcgagcggcagacggatggtccg
atctctgacaaccaggcaagaaaaagaccatcaagtccagaacccgaaagtccaagtaaa
aggttatgttccagtgaagaggttgaagtcatgtcaaagtcagtacaacagacacccagc
aaaaaagattccaggacacatgaacactaa

DBGET integrated database retrieval system