KEGG   Esox lucius (northern pike): 105020288
Entry
105020288         CDS       T04894                                 

Definition
(RefSeq) uncharacterized protein LOC105020288 isoform X2
  KO
K05461  KIT ligand
Organism
els  Esox lucius (northern pike)
Pathway
els04010  MAPK signaling pathway
els04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105020288
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    105020288
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:els04052]
    105020288
Cytokines and growth factors [BR:els04052]
 Growth factors
  Growth factors (RTK binding)
   105020288
SSDB
Motif
Pfam: SCF CagZ
Other DBs
NCBI-GeneID: 105020288
NCBI-ProteinID: XP_010885485
UniProt: A0A3P8ZDL7
LinkDB
AA seq 251 aa
MPSLNRSRVQIRTTTCVILFLLTSFGICSGGFGNPVTDDVSRLLLLLKNNIPKDYKIPIN
HIPKNMSGVCWFLLNIYPLEQSLRELAQVFGAISSNKDNIMLFITMLQNLRFKFDHEELE
VTMQMFKCHYREVKWPTGQYFDYVRAILNSAGKGKGGFRCAPPPCPAPSSAPGSEAQDHD
QTRSRGSLLCLLLIPVTACVFLIVWVVKSRTGGSPEMNQQILSSDVERASTIPIPLQQLT
SPSDVPVTGSA
NT seq 756 nt   +upstreamnt  +downstreamnt
atgccctctctgaatcggtctcgtgttcagattcggacaaccacgtgtgtcatcctattt
ctgttgacaagttttggaatatgctcaggaggatttggaaatcctgtaacagatgacgtg
agcagattgttgttgttattgaaaaacaacattccaaaagactataaaattcctataaat
catattcctaaaaatatgagtggtgtgtgctggtttctgctgaatatatatccactggaa
caaagccttagggaactggcacaggtgtttggtgccatttcgtccaacaaagataatatt
atgctcttcatcaccatgctgcaaaacctgcgcttcaaatttgatcatgaggagctggaa
gtgacaatgcaaatgtttaaatgtcactacagggaggtaaaatggccgacagggcagtat
tttgactatgtcagagccatattgaattctgcaggaaaaggaaaaggaggattccgctgt
gcaccgcccccctgcccagctccttcctcagcaccagggagtgaagcacaagaccacgat
cagactcggtcaaggggtagcctgctgtgcctgcttctgataccagtcacagcctgtgtg
ttcctcattgtatgggtggttaaatctagaacaggaggctccccagagatgaaccagcaa
atactgtcctccgatgtggagcgggcctcaaccatccccataccactgcaacaactcacc
agtccatctgatgtacctgtgacagggtctgcctga

DBGET integrated database retrieval system