KEGG   Esox lucius (northern pike): 105020341
Entry
105020341         CDS       T04894                                 

Gene name
smo
Definition
(RefSeq) smoothened homolog
  KO
K06226  smoothened
Organism
els  Esox lucius (northern pike)
Pathway
els04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    105020341 (smo)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:els04030]
    105020341 (smo)
G protein-coupled receptors [BR:els04030]
 Frizzled / Smoothened family
  105020341 (smo)
SSDB
Motif
Pfam: Frizzled Fz Dicty_CAR
Other DBs
NCBI-GeneID: 105020341
NCBI-ProteinID: XP_010885591
UniProt: A0A3P8Z683
LinkDB
AA seq 819 aa
MSSHDWSSIVAGFGMLCVWAASSLVTHALTVQRNETIFNDFCKKSTTCEVLKYNTCLGSP
LPYTHTSLVLAEDSSTQEEAFEKLAMWSGLRNAPRCWAVIQPLLCAVYMPKCENGRVELP
SQHLCQATRRPCSIVDQERGWPNFLKCEETNKFPIGCTNEVQKLKFNTSGRCEAPLVKTD
IQASWYKDVEGCGIQCDNPLFTNEEHSDMHAYIAMFGTVTLLCTFFTLATFLADWKNSNR
YPAVILFYVNACFFMGSIGWLAQFMDGARKEIVCKSDNTMRLGEPSSTETLSCVIIFSLV
YYSLMSGVIWFVMLTYAWHTSFKALGTTHQPLSGKTSYFHMVTWSIPFILTVSILAIAEV
DGDSVSGICFVGYKNYRYRAGFVLAPIGVVLVVGGYFLIRGVMTLFSIKSNHPGLLSEKA
ASKINETMLRLGIFGFLAFGFVFITFGCHFYDFFNQAEWEKSFREYVLCEANVTIAHQTN
KPIPECTIKNRPSLLVEKINLFSMFGTGIAMSTWVWTKATILIWKRTWCKIIGRSDDEPK
RIKKSKMIAKAFSKRKELHEDPEKELSFSMHTVSHDGPVAGINFDLNGEPSNDMSSAWAQ
HVTKMVARRGAILPQDISVTPTGTPVPPPEERNKLWMVEAEISPEMLKRKKKKKKKRKKE
ACPAGELADHQGYRQREFGASSVPRLPKLPGHRSLVANLRQHQEEAEDVLPGSYPESRPS
HPLPYQGRYGGDRRYADLSDLPEDLGLGPRCRPEPAPHSSWQHRDGFRYPGPVDHMAGGS
GRTAHVGRSQGGQRKAEWGQIHSRTNLMEAELMDADSDF
NT seq 2460 nt   +upstreamnt  +downstreamnt
atgtcttcccatgactggagttccattgttgcggggttcgggatgctttgcgtttgggct
gcctcctcgttggttactcatgcgttaacggtccaaagaaacgaaaccattttcaatgat
ttttgcaagaaatctacaacatgtgaagtcctaaaatataacacatgccttgggtcaccc
ttaccgtacacccacacatctcttgtcttggctgaagactcaagtactcaagaagaagcc
tttgagaagttggccatgtggtctggtctgaggaacgccccccggtgctgggctgtcatc
cagcccctgctgtgtgccgtctacatgcccaagtgtgaaaacgggcgcgtggagctcccc
agccagcacctgtgccaggccacgcgtcgtccctgcagcatcgtggaccaggagaggggc
tggcccaacttcctcaagtgcgaggagacaaacaagtttcccataggctgcacgaacgag
gtgcagaagctgaagttcaacacgtcaggacgctgcgaggcccccctggtaaagacggac
attcaggctagctggtacaaagacgtggagggctgtggcatccagtgcgacaacccgctg
ttcaccaacgaggagcactcggacatgcacgcctacatcgccatgttcggcacagtcacc
ctgctctgcactttcttcactctggccacatttctagctgactggaagaactcaaaccgc
taccctgccgtcatcctcttctacgtcaacgcctgcttcttcatgggcagtatcggctgg
ctggctcagttcatggacggagctcgcaaagagattgtgtgcaagagtgacaatacaatg
cgtttaggggagccttcgtccaccgagaccctgtcgtgcgtcatcatcttcagcctggtc
tactactcgctgatgtccggggtgatctggttcgtcatgctgacctacgcctggcacaca
tcgttcaaggccctgggcaccactcatcagcccctgtccggcaagacctcctacttccac
atggtcacctggtccatccccttcattctcactgtgtccattttagccatcgctgaggtg
gatggagactcggtcagcggtatttgttttgtcggctacaaaaactatcgctaccgtgcc
ggcttcgtgttggcgccgattggagtagtgctcgtcgtcggtggctatttcctcatacga
ggagttatgacgttgttctccatcaagagtaaccatcctggtcttctaagtgagaaagca
gcgagcaaaatcaatgagacaatgttaagacttggcatatttggattcctggcttttggt
tttgtcttcatcacttttggatgtcacttctatgacttcttcaaccaggcagagtgggag
aagagtttcagagaatatgtgttgtgcgaggccaacgtgacaatagctcaccagaccaac
aagccgatcccagagtgcaccatcaagaaccgtcccagtctgctggtggagaagatcaat
ctgttctccatgttcggcaccgggatcgccatgagcacctgggtgtggacaaaggccacc
atcctcatctggaaacggacctggtgcaagatcattggccgtagtgacgatgaacccaag
agaataaagaagagcaagatgatagccaaggccttctccaagcgtaaggagctccacgag
gacccagagaaggagctctccttcagcatgcacacggtttcccatgatgggccagtggcc
ggcatcaactttgacctgaacggggagccatccaacgacatgtcttccgcctgggcccag
catgtgaccaagatggtggcccggagaggtgccattctgccacaggacatctcagtcacc
cccacagggaccccggttccaccaccagaggagaggaacaagctgtggatggtagaggcg
gagatctccccagagatgttgaagaggaagaagaagaagaaaaagaagaggaagaaggag
gcgtgtcccgcgggggagctggctgatcaccagggctaccgccagcgggagtttggcgcc
agctcggtgccacgactgcccaagctgcccggccatcggagcctggtggccaatctgagg
cagcaccaggaggaggccgaggatgtcctaccaggctcgtacccagagtctaggccctct
catcccctgccctaccaggggaggtatggaggagaccgcaggtacgctgacctcagtgac
ctgccagaggatctgggtctgggccctcgctgccggcccgagccggcaccccattcctcc
tggcagcacagggacgggttccgctatcctgggccagtggatcatatggccggggggtct
ggtaggactgctcatgtggggaggtcgcaggggggtcaaaggaaggcggagtggggtcag
atccactctagaaccaaccttatggaggcagagctaatggacgctgactctgacttttag

DBGET integrated database retrieval system