KEGG   Esox lucius (northern pike): 105020694
Entry
105020694         CDS       T04894                                 

Definition
(RefSeq) putative transcription factor p65 homolog
  KO
K04735  transcription factor p65
Organism
els  Esox lucius (northern pike)
Pathway
els04010  MAPK signaling pathway
els04137  Mitophagy - animal
els04210  Apoptosis
els04218  Cellular senescence
els04620  Toll-like receptor signaling pathway
els04621  NOD-like receptor signaling pathway
els04622  RIG-I-like receptor signaling pathway
els04623  Cytosolic DNA-sensing pathway
els04625  C-type lectin receptor signaling pathway
els04920  Adipocytokine signaling pathway
els05132  Salmonella infection
els05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105020694
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    105020694
  09143 Cell growth and death
   04210 Apoptosis
    105020694
   04218 Cellular senescence
    105020694
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    105020694
   04621 NOD-like receptor signaling pathway
    105020694
   04622 RIG-I-like receptor signaling pathway
    105020694
   04623 Cytosolic DNA-sensing pathway
    105020694
   04625 C-type lectin receptor signaling pathway
    105020694
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    105020694
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    105020694
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    105020694
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:els03000]
    105020694
Transcription factors [BR:els03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    105020694
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 105020694
NCBI-ProteinID: XP_010886211
UniProt: A0A3P8YCK3
LinkDB
AA seq 621 aa
MAGMYGWGQPPLNQGNPFIEIIEEPKQRGMRFRYKCEGRSAGSIPGEKSNDTTKTHPAIK
VHNYNGPLHVRISLVTKNAPYKPHPHELVGKDCKHGYYEADLQERRVHSFQNLGIQCVKK
KDVAEAVSSRLQTQNNPFNIPEAKLWEEEFDLNAVRLCFQASINLPTGELCPLEPVVSQP
IYDNRAPNTAELKICRVNRNSGSCRGGDEIFLLCDKVQKEDIEVRFFQDTWEGKGTFSQA
DVHRQVAIVFRTPPYCNTNLTEPVKVKMQLRRPSDREVSEPMDFQFLPSDPDEYRLMEKR
KRTEGMFQNLKLGSLIPGSTPPERRPINTARRTVTAKPATSQPVVNPVLPPRAPLKPQQY
YNSPQPGQLFQSQPKAESSSSSSSTSTAETWKFLNSLTLDSQPKANAVPNFIDSAQTQTS
TGASLTSQAFTTVNLSDLHGFTFPTFTSSQGPTGGASIPELTSTFGVQGSQFRVETVDED
LPEFPSFSEVHPSGTLESINIDDFQALLGQSGLAVEGPGSSTASVAQAPCHLPSANTVAN
NAGQNHADPASNSCGSNTWMNYPNSIVNLLQSEVMMDSTPGNASQPAVLDDLDVFNSMDE
DRLMSILNSGNQPGFVSGHQT
NT seq 1866 nt   +upstreamnt  +downstreamnt
atggctggaatgtatggttggggacaacctcctttgaaccaagggaaccccttcatagag
atcatcgaggagcccaagcagaggggtatgaggttcaggtacaagtgtgaggggcgatcg
gcgggcagcattccgggggagaagagcaacgacaccaccaaaacacacccggctatcaag
gtgcacaactacaatgggcctcttcacgtccgcatctccttggtgaccaagaatgcccct
tacaagccccacccccacgagctggtggggaaagactgcaagcacggctactatgaggca
gaccttcaggagagacgagttcacagttttcagaatctaggcattcagtgtgtgaagaaa
aaggatgttgcggaagcagtttcctctagactgcagacccaaaacaaccccttcaacatt
ccagaggcaaagctgtgggaggaggagtttgacctgaatgcagtcaggctgtgtttccag
gcctcaatcaacctacctaccggcgaactctgccccctggagccagtggtgtcccagccc
atctacgacaaccgagcaccaaacacagcagagctgaagatctgtcgagtgaacagaaac
tctgggagctgcagagggggggatgagatcttcttactttgtgacaaagtgcaaaaagaa
gacattgaggtgcggttcttccaggacacgtgggaggggaagggtactttctcccaggca
gacgtccacaggcaggtggccatcgtgttccgcaccccgccctactgcaacaccaacctg
accgagccagtcaaagtaaagatgcagctccgcaggccctcagaccgtgaggtcagcgag
ccaatggacttccagttcctgccctctgaccctgatgaatatagactgatggagaagaga
aaacgcacagagggaatgttccagaatctgaagctggggtccttgattccagggtcaacg
ccaccagagagaaggcctatcaacactgccagaagaacggtcactgccaaaccagcaact
agccaacctgtggtgaacccagtgttgccccctcgtgcccctctgaaaccccagcagtac
tacaacagcccccagcctggccagctgttccaaagccagcccaaagcagagtcctcttca
tcatcttcgtccaccagcacggcggagacctggaagttcctcaacagccttaccctggac
tcccagcccaaagccaacgctgtgcccaatttcatcgacagtgcccagacccagacttcc
acaggtgcatccctgacctcccaggcctttaccaccgtcaacttgtcggacctccacggc
ttcactttccccaccttcactagttcccagggaccaacgggcggagcttccattccagaa
ctcacctctaccttcggggtccagggttcccaattcagggtggagacagtggacgaggat
ctcccggagttccccagcttctccgaggtgcacccctcaggaaccctggagagcatcaac
atcgacgacttccaagctctgctgggccagagcggtctggctgtagagggtccagggagc
agcacggcgtcggtcgcccaggcaccctgccacttgccctccgccaacactgtggccaac
aatgcgggccagaaccacgcagacccagccagcaacagctgcggcagcaacacctggatg
aactacccgaacagcatcgtcaacctgctccagagtgaggtcatgatggacagtaccccc
ggcaacgccagccagccagccgtccttgacgatctggacgtcttcaactccatggacgag
gaccgcctcatgtccatcctgaacagtggcaaccagcctggcttcgtgtccggacatcag
acatga

DBGET integrated database retrieval system