KEGG   Esox lucius (northern pike): 105020942
Entry
105020942         CDS       T04894                                 

Gene name
hhip
Definition
(RefSeq) hedgehog-interacting protein
  KO
K06231  hedgehog interacting protein
Organism
els  Esox lucius (northern pike)
Pathway
els04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    105020942 (hhip)
SSDB
Motif
Pfam: GSDH EGF_2 EGF_Tenascin
Other DBs
NCBI-GeneID: 105020942
NCBI-ProteinID: XP_019899172
LinkDB
AA seq 697 aa
MRHLKFVLVLAIAVNVWECGDAKFGEKGESSPRRRRCYDGSMPKRLKKRDRKLSVDGGAS
SGEVCHRLYPRVSCCPTRRAAYQIVHRRDARIFSTNNTECSRLLEEIKCARCSPNAQVLF
HSAESDKVPLREPHLPRLCQDYCREFYYTCRGHIPELFQADVDEFCQYYGKRDGGLCFPD
FQRKQTRGQDSNYLGDENVEDINRKHKHNCYCAQEVLSGLRQPVAVVHCGDGSQRLFVLE
REGFVRVLTHNMELLKEPFLDIHKMVQSGLKGGDERGLLSLAFHPNYKKNGKLYVSYTTN
QERWAIGPHDHILRVVEYTVSRKNPNMVESRTTRVLMEVAELHRKHLGGQLLFGPDGLLH
IVLGDGMITLDDMEEMDGLSDFTGSVLRVDVDTDCCAAPYSIPRNNPYFNSTNQPPEIFA
HGLHDPGRCAVDRDSTDINGSLSLLCTDASGKNSSAGRILEITKGKDYENEASIFDLAAS
GGAAPVGGFVYRGCQSRRLYGSYVFGDKNGNLRILQKSTAAMRGHWQEKSLCLGTSSFCG
SALVGHILGFGEDELGEVYILASSKSMAQSHSGKLYKLVDPKRPVVPKECQRQAEAPELL
GTACSWQCKNGHCTPTGTCCCSAGWEGPFCRVAKCEPACRSGGVCVEPNACLCKSGYSGA
ECEKGERGMPSDQEKDGILDHIIDMTSYLLDLTSYIV
NT seq 2094 nt   +upstreamnt  +downstreamnt
atgaggcacttgaaatttgtgctcgtgttggctatcgcagtcaacgtgtgggaatgtggg
gatgcgaaatttggcgaaaagggagagagcagtccgaggagaaggagatgttacgacggg
agcatgcccaagcgactgaagaaaagggataggaaactgtcagtcgacggcggtgcgagc
agcggggaagtttgtcacaggttgtaccctcgtgtgtcctgctgccccaccaggcgtgct
gcttatcaaatagtccaccggagggacgccaggatcttctccaccaataacacagagtgc
agccgtctcctggaggagatcaagtgtgcgcgttgttcacccaacgcccaggtgctgttc
cactccgcagagtcagacaaagtccccctcagggagccccacctgccacgtctctgccag
gactactgcagagagttttactacacctgccgcggacacatacctgagctgttccaggcc
gacgtggatgaattctgccagtattacggcaagagggacggaggcttgtgcttccccgat
tttcagcgaaaacaaacgcgggggcaagactccaactacctgggtgatgagaacgtcgaa
gacataaacaggaaacacaagcacaactgctactgtgcccaggaggtgttgagtggcctg
aggcagccggtggctgtggtccactgtggggacggatcccagcgtctctttgtcctggag
agggaaggttttgtccgggtgctcacccacaacatggagctgctgaaagagcccttcctg
gacatccacaagatggtgcagagtggactcaaggggggagatgaaaggggcctgctgagc
ctggcgttccaccccaattacaagaagaacggcaagctgtatgtctcctacaccaccaac
caggagcgatgggccatcgggccccatgaccacatcctgcgcgtggtggagtacaccgtc
tccaggaaaaaccccaacatggtggaaagtcggaccacgcgcgtgctgatggaggtggcc
gagctccacaggaagcacctggggggtcaactgctgtttggcccggacggcctgctacac
atcgtcctgggagacggcatgatcaccttggacgacatggaggagatggacggactaagt
gatttcacagggtccgttctgagggtggacgtggacacagactgctgcgcggccccttac
tccatccccaggaacaacccctacttcaacagcaccaaccagccgccggagatcttcgca
cacgggctgcacgacccaggcaggtgtgcagtggaccgagattcgacagacatcaatggg
agcctctcgttgctgtgcaccgatgccagcgggaagaactcgtccgccgggagaatactg
gagatcaccaaagggaaagactacgaaaatgaggcatccatctttgatttggcggctagt
ggaggagccgcccccgtaggaggtttcgtctacagaggatgtcagtccagaagactttac
gggagctatgttttcggagacaagaacgggaacctgcggatcctccagaagagcacagca
gcgatgcggggccactggcaggagaagtctttgtgcctggggaccagcagcttctgcggg
tctgcactggtgggacacatcctaggtttcggagaggatgaactaggtgaagtgtacatc
ctcgccagcagtaaaagtatggctcagtcacacagtgggaaactctacaagctggtcgac
cctaaacggccggtggtcccgaaggagtgtcagaggcaggcggaagccccggagctcctg
ggcacggcgtgctcgtggcagtgtaagaacggacactgcacgcccacggggacgtgttgc
tgcagcgctggctgggagggcccgttctgcagagtggctaaatgcgagccggcctgtcgg
agcggcggcgtgtgtgtggagcccaacgcgtgtctgtgcaagagcggctactcgggcgcc
gagtgcgagaagggcgagcgtggcatgccgagcgaccaggagaaggacggcatcctggac
cacatcatagacatgacctcctacctgctggatctcaccagctacatcgtatag

DBGET integrated database retrieval system