KEGG   Esox lucius (northern pike): 105021333Help
Entry
105021333         CDS       T04894                                 

Gene name
hk1
Definition
(RefSeq) hexokinase-1 isoform X1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
els  Esox lucius (northern pike)
Pathway
els00010  Glycolysis / Gluconeogenesis
els00051  Fructose and mannose metabolism
els00052  Galactose metabolism
els00500  Starch and sucrose metabolism
els00520  Amino sugar and nucleotide sugar metabolism
els00524  Neomycin, kanamycin and gentamicin biosynthesis
els01100  Metabolic pathways
els01200  Carbon metabolism
els04910  Insulin signaling pathway
Module
els_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
els_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:els00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    105021333 (hk1)
   00051 Fructose and mannose metabolism
    105021333 (hk1)
   00052 Galactose metabolism
    105021333 (hk1)
   00500 Starch and sucrose metabolism
    105021333 (hk1)
   00520 Amino sugar and nucleotide sugar metabolism
    105021333 (hk1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    105021333 (hk1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    105021333 (hk1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:els04131]
    105021333 (hk1)
Enzymes [BR:els01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     105021333 (hk1)
Membrane trafficking [BR:els04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    105021333 (hk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 CSD
Motif
Other DBs
NCBI-GeneID: 105021333
NCBI-ProteinID: XP_010887226
LinkDB All DBs
AA seq 919 aa AA seqDB search
MIAAQLLAYYFTELKDDKVKKIDKYLYAMRFSDETLLDIMNRFKIELVNGLGRDTNPTAT
VKMLPTFVRSIPDGSEKGDFIALDLGGSAFRILRVKVSDEKKQTVQMESQVYDTPEDIIH
GSGTQLFDHVAECLGDFIEKQNIKDKKLPVGFTFSFPCAQTKLNESYLLNWTKRFKASGV
EGMDVVALLNKAIKKRGDYEADIMAVVNDTVGTMMTCGFDDQRCEVGIIIGTGTNACYME
EMRHIDLVEGDEGRMCINTEWGAFGDDGMLEDIRTEFDREIDRGSLNPGKQLFEKMVSGM
YMGELVRLILVKMAKEGFLFEGRITPELLTKGTFETKHVSAIEKSKDGLTKAKEILARLG
VEPSTDDCIAVQHVCNIVSHRSANLIAATLGGILSRIKDNKGNPRLRTTVGIDGSLYKMH
PQYSRRLHKTVRRLVPESDVRFLLSESGSSKGAAMVTAVAYRLADQRRQITETLAEFNLN
NDQLLEVKKRMKTEIQNGLGRKTHDSATVKMWPTYVRSTPDGSENGDFLALDLGGTNFRV
LLVKIRSGKRRTVEMHNKIYAIPLEVMQGTGEELFDHIVHCISDFLDYMGMKNTRLPLGF
TFSFPCRQTSLDEGILVTWTKGFKATDCEGEDVVSLLREGIKRREEFDLDVVAVVNDTVG
TMMTCAHEEPTCEVGLIAGTGSNACYMEEMRNVETVEGDEGRMCVNMEWGAFGDNGCLDD
IRTEFDRFVDEFSLNPGKQRYEKMCSGMYLGEIVRNILITLTKRGFLFRGQISETLKTRG
IFETKFLSQIESDRLALLQVRSILQHLGLDSTCDDSIIVKEVCGVVSRRAAQLCGAGMAA
VVDKIRENRGLNQMNITVGVDGTLYKLHPHFSRIMHQTVKELAPKCNVNFLLSEDGSGKG
AALITAVGCRLRAEEQKKS
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atgatagcagcacagcttctggcctactacttcactgagttgaaggatgacaaggtcaaa
aagattgataagtacctgtacgccatgcgtttctcagacgagacgttgttggacatcatg
aatcgcttcaagatagaactggtaaatgggctgggccgggacacaaacccaacagcaact
gtcaagatgttgcccacctttgtcaggtccattcctgatggatcagaaaagggggacttc
atagctctggatctaggaggatcagccttccgcatcctgcgagtgaaggtgtccgatgag
aagaagcagacagttcagatggagagccaggtctatgacacccctgaggacatcatccat
ggcagtggcactcagctgtttgaccatgttgcagagtgcctgggtgacttcattgaaaag
cagaatattaaggacaagaagcttccagttggcttcaccttctcatttccctgtgcacaa
accaaactgaatgagagttatttgctcaattggactaagcgctttaaagccagtggagtg
gaggggatggacgtggtggcgcttctgaacaaggccatcaaaaaacgtggggactatgaa
gcagacatcatggcagtggttaacgacacagtaggaaccatgatgacctgcggctttgac
gaccagcgctgtgaagtgggaataatcataggcacaggtactaacgcctgttacatggag
gagatgagacacatcgacctggtggagggagacgagggcaggatgtgtatcaacactgag
tggggggccttcggggacgatgggatgctggaggacattcgcacagagtttgacagagaa
attgacaggggctctcttaacccaggaaagcagctgtttgagaagatggtcagcggaatg
tacatgggcgaacttgtgcgacttatcctggtcaagatggccaaagaggggttcttgttt
gagggtcggataacccctgaacttcttaccaaagggacatttgaaaccaaacatgtttct
gccattgaaaaaagtaaagatggtctcaccaaagccaaggagatcctggctcgtctagga
gtggaaccatccaccgacgactgcatcgccgtgcagcacgtatgcaacatagtctcccac
agatcggccaacctcatcgctgccactctgggcggcatcctctccaggattaaggacaac
aaagggaaccctcgccttcgtaccaccgtgggcatcgatggctcactttacaagatgcac
ccacaatattccaggcgtctccacaaaacagtccgccgcctagttcctgaatcagatgtc
cgcttcctgctctcagagagcgggagctccaagggtgccgccatggtgaccgccgtggcc
tatcggctggccgaccagcgtcgtcagatcaccgagaccctggcggaattcaatctgaac
aatgatcagctgctggaagtgaagaagaggatgaagacagagatccagaatggcctgggg
agaaagacccatgacagcgccaccgtgaagatgtggccaacatatgtacgcagtacacca
gatggatcagaaaatggtgatttcttggctctggatttaggagggacaaactttagagtg
ttgttggtaaagatccgcagtggcaagcggaggacagtagagatgcataacaagatttat
gccatccctttggaggtgatgcaggggaccggagaggagctcttcgaccacattgtccac
tgtatatctgactttctggattacatggggatgaagaacactcgcctgccactaggcttc
accttctcttttccctgcagacagacgagcctggacgagggcatcctggtaacctggacc
aaaggtttcaaagccacggactgtgaaggggaggatgtggtgtctcttctcagagagggg
attaaaaggagagaggagtttgacttggacgtggtggccgtggtcaatgacacagtgggg
accatgatgacctgtgcacatgaagagcccacctgtgaggttggcctgattgcaggaact
ggcagcaatgcctgttacatggaggagatgaggaacgttgagacggtggagggagatgag
ggcaggatgtgtgtcaacatggagtggggggcatttggggacaacgggtgcctggacgac
atcaggacagaatttgacagatttgtggatgagttttcactcaaccctggcaagcaaagg
tacgagaagatgtgcagcggtatgtatctaggggagattgtgcgaaacatcctgatcacg
ttgacgaagcggggcttcctcttcagagggcagatatcagagactctgaagaccagaggc
attttcgaaactaagttcctctcccagattgaaagtgacagattggcactgcttcaggtg
aggtccatcctgcagcacctgggtctggacagcacgtgtgacgacagcatcatcgtcaag
gaggtgtgtggcgtcgtgtctcgccgggcggctcagctctgtggggccggaatggccgct
gtcgtcgacaaaatccgggagaaccgcgggctgaaccaaatgaacatcaccgtgggggtg
gacggaacactctacaaactgcatccacacttttcgaggatcatgcaccagacagtgaaa
gagctggcccctaagtgcaacgtcaatttccttctgtctgaggacgggagtggaaagggg
gccgccctcatcactgccgtgggctgccgcttgcgtgcagaagagcagaagaagagctga

DBGET integrated database retrieval system