KEGG   Esox lucius (northern pike): 105021749Help
Entry
105021749         CDS       T04894                                 

Gene name
aldh7a1
Definition
(RefSeq) alpha-aminoadipic semialdehyde dehydrogenase
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
els  Esox lucius (northern pike)
Pathway
els00010  Glycolysis / Gluconeogenesis
els00053  Ascorbate and aldarate metabolism
els00071  Fatty acid degradation
els00260  Glycine, serine and threonine metabolism
els00280  Valine, leucine and isoleucine degradation
els00310  Lysine degradation
els00330  Arginine and proline metabolism
els00340  Histidine metabolism
els00380  Tryptophan metabolism
els00410  beta-Alanine metabolism
els00561  Glycerolipid metabolism
els00620  Pyruvate metabolism
els01100  Metabolic pathways
Module
els_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
els_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:els00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    105021749 (aldh7a1)
   00053 Ascorbate and aldarate metabolism
    105021749 (aldh7a1)
   00620 Pyruvate metabolism
    105021749 (aldh7a1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    105021749 (aldh7a1)
   00561 Glycerolipid metabolism
    105021749 (aldh7a1)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    105021749 (aldh7a1)
   00280 Valine, leucine and isoleucine degradation
    105021749 (aldh7a1)
   00310 Lysine degradation
    105021749 (aldh7a1)
   00330 Arginine and proline metabolism
    105021749 (aldh7a1)
   00340 Histidine metabolism
    105021749 (aldh7a1)
   00380 Tryptophan metabolism
    105021749 (aldh7a1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    105021749 (aldh7a1)
Enzymes [BR:els01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     105021749 (aldh7a1)
    1.2.1.8  betaine-aldehyde dehydrogenase
     105021749 (aldh7a1)
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     105021749 (aldh7a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-GeneID: 105021749
NCBI-ProteinID: XP_010887934
LinkDB All DBs
AA seq 540 aa AA seqDB search
MQRCFTLSVVRYWALRKKVLTFNFQQSAAMSTLLINEPKYAWLKELGLSEDNDGVYNGTW
GGKGEVITSYCPANNEPIARVRQATMAEYEETVQKCREAWKVWADIPAPKRGEIVRQIGD
ALRKKIKVLGSLVSLEMGKIYVEGVGEVQEYVDVCDYAVGLSRMIGGPVLPSERPGHALI
EMWNPVGLVGIITAFNFPVAVYGWNNAIALICGNVCLWKGAPTTPLTSVAVTKIVAEVLE
QNNLPGAICSMTCGGADIGTAMSKDERMDLVSFTGSTHVGKMVAMTVQERFGRNLLELGG
NNAIIVFEDADLSLVVPSAVFASVGTAGQRCTTTRRLMLHESVHDVVVERVAKAYKQVRI
GDPWDPSTLYGPLHTQQAVDQYLAAINQAKQQGGTVVCGGKVMDRPGNYVEPTIITGLPH
DAPIVHTETFVPILYVLKFKTEEEAFAWNNEVKQGLSSSIFTKDMGRVFRWLGPKGSDCG
IVNVNIPTSGAEIGGAFGGEKHTGGGRESGSDSWKQYMRRSTCTINYSKDLPLAQGIKFE
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgctgtttcactttatccgttgtacggtactgggcccttcggaagaaggttctg
acattcaacttccaacaatctgctgccatgtctacgcttctgataaacgagcccaaatat
gcctggctgaaagagttaggtcttagtgaggataatgatggcgtttacaacgggacttgg
ggaggcaaaggcgaggtcatcacatcatattgccctgccaacaatgagccaattgccaga
gtacgccaggcaaccatggcagaatatgaagaaactgtgcagaaatgtagggaagcctgg
aaggtttgggcagatattccggcccccaaaagaggggagattgtgcgacagattggcgat
gctctgaggaaaaagattaaagtcctgggcagcctggtgtccctggagatggggaagatc
tatgttgagggggttggcgaggtgcaggaatacgtagacgtctgtgattacgccgttggc
ctttctcgcatgatcggtggtcccgttctcccttctgaaagaccaggtcatgcgcttatc
gagatgtggaaccctgttggcctggtgggcattataacagcctttaacttccctgtggcg
gtctacggctggaacaacgccatcgccctcatctgtggcaacgtttgtctgtggaaaggc
gctcccacaactcccctcaccagtgtagctgtaaccaaaatcgtggcagaggtgctggag
cagaacaacctgcctggcgccatctgctccatgacgtgtggcggcgcggacatcggcaca
gcgatgtccaaggacgagcgcatggacctggtgtcattcactggcagcactcacgtgggc
aagatggtggccatgaccgtgcaggagaggtttggtcggaaccttttggaacttggtggg
aacaatgcaatcatagtgtttgaggatgctgatctgagccttgtggttccctctgccgtc
tttgcgtccgtgggaactgccgggcaacggtgcacgaccaccagaagactgatgctgcac
gaaagcgtccacgacgtggtggtggagagggtagccaaagcctacaaacaagtccgcatc
ggagacccctgggaccccagcacgctgtatggcccgctacatacccagcaagctgtggac
cagtacctggcggccattaatcaggccaaacagcagggcggcactgtggtgtgtggagga
aaggtgatggatcgtcctgggaactacgtggagcccaccatcatcacagggctacctcac
gacgcacccatcgttcacacggagacctttgtccccatcctctatgtcctgaagttcaag
actgaggaagaggcgtttgcctggaacaacgaggtcaagcagggcctctctagcagcatc
ttcaccaaggatatgggccgtgtcttccgctggctagggcctaaagggtccgactgcggc
attgtgaacgtcaacattcccaccagcggagctgagatcggaggcgccttcggtggggag
aaacacaccggcggtggacgtgagtcaggcagcgactcgtggaagcagtacatgagaagg
tccacatgcaccatcaattacagcaaggacctccctcttgctcagggaatcaagtttgag
tga

DBGET integrated database retrieval system