KEGG   Esox lucius (northern pike): 105022041
Entry
105022041         CDS       T04894                                 

Gene name
cul1
Definition
(RefSeq) cullin-1
  KO
K03347  cullin 1
Organism
els  Esox lucius (northern pike)
Pathway
els04110  Cell cycle
els04114  Oocyte meiosis
els04120  Ubiquitin mediated proteolysis
els04141  Protein processing in endoplasmic reticulum
els04310  Wnt signaling pathway
els04340  Hedgehog signaling pathway
els04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:els00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    105022041 (cul1)
   04120 Ubiquitin mediated proteolysis
    105022041 (cul1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    105022041 (cul1)
   04340 Hedgehog signaling pathway
    105022041 (cul1)
   04350 TGF-beta signaling pathway
    105022041 (cul1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    105022041 (cul1)
   04114 Oocyte meiosis
    105022041 (cul1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:els04121]
    105022041 (cul1)
Ubiquitin system [BR:els04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Cullin
     105022041 (cul1)
SSDB
Motif
Pfam: Cullin Cullin_Nedd8
Other DBs
NCBI-GeneID: 105022041
NCBI-ProteinID: XP_010888457
UniProt: A0A3P8ZV65 A0A3P8ZWB0
LinkDB
AA seq 776 aa
MSSNRNQNPHGLKQIGLDQIWDDLRAGIQQVYTRQSMAKSRYMELYTHVYNYCTSVHQSS
QGRGSAAPTKPSKKSSTPGGAQFVGLELYKRLKEFLKNYLTSLLMDGEDLMDECVLKFYT
QQWEDYRFSSKVLNGICAYLNRHWVRRECDEGRKGIYEIYSLALVTWRECLFRPLNKQVT
NAVLKLIEKERNGETINTRLISGVVQSYVELGLNEEDAFAKGPTLSVYKEYFECQFLTDT
ERFYTRESTEFLQQNPVTEYMKKAEARLLEEQRRVQVYLHESTQDELARRCEQVLIEKHL
EIFHTEFQNLLDADKNEDLGRMYNLVSRITDGLGELKKLLETHIHNQGLAAIEKCGEAAL
NDPKVYVQTTLNVHKKYNALVMSAFNNDAGFVAALDKACGRFINNNAVTKMAQSSSKSPE
LLARHCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNSA
SDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDLDFSIQVL
SSGSWPFQQSCTFALPSELERSYQRFTAFYGSRHSGRKLTWLYHLSKGELVTNCFKNRYT
LQASTFQMAILLQYNAEVLYTVQQLTDSTQIKTDILVQVLQILLKSKLLVLEDENANVDE
VDFKPETLIKLFLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMK
MRKVLKHQQLLAEVLNQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA
NT seq 2331 nt   +upstreamnt  +downstreamnt
atgtcgtccaacaggaaccagaaccctcacgggctgaagcagatcgggctggaccagatc
tgggacgacctgagggccggcatccagcaggtgtacacacggcagagcatggccaagtcc
cgctacatggagctctacacccatgtgtataactactgcaccagcgtgcatcagtccagc
cagggccgtggctccgccgcccccaccaagccctccaagaagagcagcacgccgggcggg
gcccagttcgtcggcctggaactctacaagaggctcaaggagttcctgaagaactacctg
accagtctactcatggatggcgaagacctgatggacgagtgtgtgttgaagttctacacc
cagcagtgggaggactaccggttctccagcaaggtgctgaacgggatctgcgcctacctg
aaccggcactgggtcagacgggagtgtgacgaggggcgcaagggcatctacgagatctac
tcgttggctttggtgacatggagggagtgtctgttcaggcccctgaacaaacaggtaacg
aacgccgtgctgaaactgatagagaaggagaggaacggagagaccatcaacaccaggctc
atcagtggcgtggtccagtcctacgttgaactggggctgaacgaggaggacgccttcgcg
aagggccccactctgtccgtgtacaaggagtacttcgagtgccagttccttacggacacc
gagcgcttctacacacgggagagcaccgagtttctccagcagaaccctgttactgagtac
atgaagaaggcggaggcccgtctgttagaggagcagaggcgtgttcaggtgtacctccac
gagtccacccaggacgagctggccaggaggtgcgaacaggtgctcatagagaaacacctg
gagatcttccacacagagttccagaacctgctggatgcggacaagaacgaagatctgggt
cgtatgtataacttggtgtcgcgtataacggatggactgggagagctgaagaaacttcta
gaaactcacatccacaaccagggcctggccgccatcgagaaatgtggagaggctgctctc
aatgaccctaaggtgtatgtccagaccactctgaacgtccataagaagtacaacgctctg
gtcatgtccgccttcaacaacgacgctggcttcgtggctgcgcttgacaaggcctgtggt
cgtttcatcaacaacaacgcggtcactaagatggcccagtcctccagcaagtcaccggag
ctcctggccaggcactgtgactccctgctgaagaagagttctaagaacccagaggaggcg
gagttggaggacacactcaaccaagtgatggtggtgtttaagtacatcgaggacaaggat
gtgttccagaagttctacgctaagatgttggccaaacgcctcgtccaccagaacagtgcc
agcgacgacgccgaggccagcatgatctccaaactcaagcaagcgtgcggctttgagtac
acgtccaaactccagcggatgttccaggatatcggagtgagcaaagacctcaacgagcag
ttcaagaaacacctgaccaactcggaacccctcgacttggacttcagcatccaggtgttg
agctcaggttcctggccattccagcagtcgtgcacctttgccctgccgtccgagctggag
cgcagctaccagcggttcacggcgttctacggcagccggcacagtgggcggaagctcacc
tggctctaccacctgtccaaaggagagctggtcaccaactgcttcaagaacaggtacact
cttcaagcctccaccttccagatggccatcctgctacagtacaatgcagaggtcctgtac
accgttcagcagctcactgacagcactcagatcaagactgacattctggttcaagtgttg
cagatcttgttgaagtccaaattgctggtcctggaggatgagaatgctaatgtagacgag
gtggacttcaaaccagaaaccctgatcaaactcttcctgggatacaagaacaagaagctg
cgtgtgaacatcaacgttcctatgaagaccgagcagaaacaagagcaggagaccacacac
aagaacatagaggaggaccgaaaactcctcatacaggctgccatcgtgaggataatgaaa
atgaggaaggttctgaaacaccagcagcttctggctgaagtcctcaaccagctctcctct
cgcttcaaacccagagtccctgtcatcaagaagtgtatagacatcctgatagagaaggag
tatctggagagagtcgacggtgagaaagacacgtacagctacctggcttaa

KEGG   Esox lucius (northern pike): 105024245
Entry
105024245         CDS       T04894                                 

Definition
(RefSeq) cullin-1
  KO
K03347  cullin 1
Organism
els  Esox lucius (northern pike)
Pathway
els04110  Cell cycle
els04114  Oocyte meiosis
els04120  Ubiquitin mediated proteolysis
els04141  Protein processing in endoplasmic reticulum
els04310  Wnt signaling pathway
els04340  Hedgehog signaling pathway
els04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:els00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    105024245
   04120 Ubiquitin mediated proteolysis
    105024245
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    105024245
   04340 Hedgehog signaling pathway
    105024245
   04350 TGF-beta signaling pathway
    105024245
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    105024245
   04114 Oocyte meiosis
    105024245
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:els04121]
    105024245
Ubiquitin system [BR:els04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Cullin
     105024245
SSDB
Motif
Pfam: Cullin Cullin_Nedd8
Other DBs
NCBI-GeneID: 105024245
NCBI-ProteinID: XP_010892380
UniProt: A0A3P8YCS4 A0A3P9A395
LinkDB
AA seq 777 aa
MSSNRSQNPHGLKQIGLDQIWDDLRAGIQQVYTRQSMAKSRYMELYTHVYNYCTSVHQSN
QARGAGPPPSKPSKKAPTPGGAQFVGLELYKRLKEFLKNYLTNLLKDGEDLMDESVLKFY
TQQWEDYRFSSKVLNGICAYLNRHWVRRECDEGRKGIYEIYSLALVTWRECLFRPLNKQV
TNAVLKLIEKERNGETINTRLISGVVQSYVELGLNEDDAFAKGPTLSVYKEYFETQFLAD
TERFYTRESTEFLQQNPVTEYMKKAEARLLEEQRRVQVYLHESTQDELARKCEQVLIEKH
LEIFHTEFQNLLDADKNEDLGRMYNLVSRITDGLGELKKLLETHIYNQGLAAIEKCGEAA
LNDPKMYVQTILDVHKKYNALVMSAFNNDAGFVAALDKACGRFINNNAVTKMVQSSSKSP
ELLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNS
ASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDLDFSIQV
LSSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYHLSKGELVTNCFKNRY
TLQASTFQMAILLQYNTEDVYTVQQLTDSTQIKIDILVQVLQILLKSKLLVLEDENANVD
EVEFKPDTLIKLFLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIM
KMRKMLKHQQLLAEVLNQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA
NT seq 2334 nt   +upstreamnt  +downstreamnt
atgtcatccaaccgaagccaaaatccacatgggctcaaacagattggcctggaccagatc
tgggatgacctgcgtgcgggaatacaacaggtgtacaccagacagagcatggccaaatca
cgatacatggagctctacacacatgtttacaactactgcaccagtgtacaccagtccaat
caggcccgtggggcaggccccccgccatccaagccctccaaaaaagcccccacccctgga
ggggcccagtttgtgggtctggagctctacaagagactgaaggagttcctcaagaactat
ttgaccaacctgctcaaagatggagaagatctcatggatgagagtgtattgaagttctac
acacagcagtgggaagactacagattctccagcaaagtgctgaatggtatctgtgcctac
ctcaaccgacactgggtccgccgtgagtgtgatgaggggcgaaaagggatctatgaaatc
tactccctcgctttggtgacatggagggaatgccttttcagacctctgaataaacaagtc
acaaatgctgtattgaagctcatcgagaaggaacgtaatggagagaccattaacaccaga
cttatcagtggagtcgtccagtcctacgttgagttgggtctcaacgaggatgatgccttt
gccaaaggacccacattgtcggtctacaaagagtactttgagacacagtttttggcggac
accgagcgcttctacacacgagagagcacagagttccttcaacaaaaccctgtcactgag
tacatgaagaaggcggaggcacgtctgttagaggagcagcggagggtgcaggtgtacctc
cacgagagcacacaggatgagctggcccgcaagtgcgagcaggtgcttatcgaaaagcac
ctggagatcttccacacggagttccagaaccttctggacgctgacaaaaatgaagacctt
ggacgtatgtacaatttggtgtcccggatcactgatgggttaggagagctaaagaaactc
ctggagacacacatttacaaccagggcctggctgctatagagaaatgtggagaagcagct
ctcaatgatcccaaaatgtatgtccagaccatcttagacgttcacaagaagtacaacgcg
ttagtaatgtcagcattcaacaatgatgctggtttcgttgcggctcttgacaaggcatgt
ggacgcttcatcaacaacaatgctgtgaccaagatggtgcagtcgtccagcaaatcccca
gagctgctagctcgatactgtgactctctgctgaagaagagttccaagaacccagaggag
gctgagctggaggacacattaaaccaagtgatggtggtcttcaagtacatagaggacaaa
gatgtgttccagaagttctatgccaagatgctggctaagcggttagtacatcagaacagt
gccagtgacgatgccgaagcaagtatgatctccaagttgaagcaagcttgtggctttgag
tacacctccaaactccagcgcatgttccaggacatcggagtcagcaaagacctaaatgaa
caattcaaaaagcacctcaccaactctgagcctttggacttggacttcagcatccaggtt
ctcagttctggttcctggccctttcagcagtcctgtactttcgctttgccctctgagctg
gagaggagttaccagcggttcacggccttctacgccagccgacacagcgggcgcaagctg
acctggctctaccacctgtccaaaggagagctggtcaccaactgcttcaagaatagatac
accctccaggcctccacgttccagatggccatcctactgcagtacaacactgaggacgtc
tacacagtgcagcagctcaccgacagcacacagatcaagattgacattttggtgcaggtg
ttgcaaatcttgttgaagtctaagttgctggtcctggaagatgagaatgcaaatgtggat
gaagtggagttcaaaccagacaccttaataaaactatttttaggatacaaaaacaaaaag
cttcgggtaaacattaacgtgccaatgaagacggagcagaaacaagaacaggaaaccact
cacaagaacatagaggaagacaggaaactgttaatacaggcggctatcgtgagaataatg
aagatgcggaaaatgctgaaacatcagcagctcctggcagaggttctaaaccagctgtca
tccaggttcaaacccagagtccccgtcatcaagaaatgtatcgacatcctgatcgagaaa
gaatacctggagcgtgtcgacggagagaaagacacttacagctacttggcttaa

DBGET integrated database retrieval system