KEGG   Esox lucius (northern pike): 105022460Help
Entry
105022460         CDS       T04894                                 

Gene name
b3galt1
Definition
(RefSeq) beta-1,3-galactosyltransferase 1
  KO
K07819  beta-1,3-galactosyltransferase 1 [EC:2.4.1.86]
Organism
els  Esox lucius (northern pike)
Pathway
els00601  Glycosphingolipid biosynthesis - lacto and neolacto series
els01100  Metabolic pathways
Module
els_M00070  Glycosphingolipid biosynthesis, lacto-series, LacCer => Lc4Cer
Brite
KEGG Orthology (KO) [BR:els00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    105022460 (b3galt1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:els01003]
    105022460 (b3galt1)
Enzymes [BR:els01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.86  N-acetyl-beta-D-glucosaminide beta-(1,3)-galactosyltransferase
     105022460 (b3galt1)
Glycosyltransferases [BR:els01003]
 Glycan extension
  Type 1 chain
   105022460 (b3galt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Galactosyl_T
Motif
Other DBs
NCBI-GeneID: 105022460
NCBI-ProteinID: XP_010889199
LinkDB All DBs
AA seq 329 aa AA seqDB search
MPSKVSCLYVLTVVCWASALWYLSLSRPTSSYVSGQLSLPIRKTVKTLKNGTFSNIRTRT
LNPHAFDFVINEPKKCETNTPFLVILISTTHKEFDARQAIRETWGDESTYSDIRIITLFL
LGRNTDPVLNQMVEQESQIFHDIVVEDFIDSYHNLTLKTLMGMRWVATFCSQAQYVMKTD
SDIFVNMDNLVYKLLKPATKPKRRYFTGYVINGGPIRDMRSKWYMPRDLYPEAKYPPFCS
GTGYVFSVDVAELIYKTSLHTRLLHLEDVYVGLCLRKLGIHPYQNSGFNHWKMAYSLCRY
RRVITVHQISPEEMHRIWNDMSSKKHLRC
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgccttcaaaggtctcatgcttgtacgtgttgacagtcgtttgctgggcaagtgctctt
tggtacttgagtttatcccgcccgacgtcctcctatgtgagtgggcagctttctttgcct
atccggaagactgtgaaaaccctcaagaacggcacattcagcaacatccgcacacgaacg
ctgaacccacacgcctttgactttgtcatcaacgagcctaagaaatgtgagaccaacacg
cccttcctggtcatccttattagcaccacgcacaaagagtttgacgccaggcaggccatt
cgggagacgtggggagatgagagcacctacagcgatatccgcatcatcaccctcttcctg
ttgggccgcaacacggacccggtcctcaaccagatggtggagcaggagagccagatcttc
cacgacatcgtggtggaggacttcatagactcgtaccacaacctcactctcaagacactg
atgggcatgcgctgggtggctaccttctgctcccaggcccagtacgtcatgaagacggac
agtgacatctttgtcaacatggacaatctggtgtacaagctcctgaagcccgccaccaag
cccaaaaggaggtacttcacgggctacgtcatcaatggaggtcccatcagagacatgcgt
agtaagtggtacatgccccgagacctgtaccctgaagccaagtacccgccgttctgctcg
ggcacgggttacgtgttctcagtggacgtggcagagctcatctataagacctctctgcac
accagactgctccacctggaggatgtatacgtggggctgtgtctgcggaagctgggcatt
cacccctatcagaacagtggcttcaatcactggaagatggcctacagcctgtgcaggtac
cgtcgtgttataactgtccaccagatctccccagaagaaatgcatcggatatggaatgac
atgtccagcaagaaacacctcagatgctaa

DBGET integrated database retrieval system