KEGG   Esox lucius (northern pike): 105022482Help
Entry
105022482         CDS       T04894                                 

Gene name
gad1
Definition
(RefSeq) glutamate decarboxylase 1 isoform X1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
els  Esox lucius (northern pike)
Pathway
els00250  Alanine, aspartate and glutamate metabolism
els00410  beta-Alanine metabolism
els00430  Taurine and hypotaurine metabolism
els00650  Butanoate metabolism
els01100  Metabolic pathways
Module
els_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:els00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    105022482 (gad1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    105022482 (gad1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    105022482 (gad1)
   00430 Taurine and hypotaurine metabolism
    105022482 (gad1)
Enzymes [BR:els01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     105022482 (gad1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase SepSecS Chlam_OMP3
Motif
Other DBs
NCBI-GeneID: 105022482
NCBI-ProteinID: XP_010889235
LinkDB All DBs
AA seq 586 aa AA seqDB search
MAASAPSSSTGEPDPNSTNLRPPGSSYDAWCGVAHGCTRKLGMKICGFLQKNNNLEEKIS
SLKEKPSKDLLDNSDRDSRFRRTETDFSNLYARDLLPAKNGEEPTMQFLLEVVDILTNYV
RKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDQPESLEQILVDCRDTLKYGVRTGHPRFF
NQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQLTLRKMREIIGWPNGEGDGIF
SPGGAISNMYSVMIARYKFFPEVKAKGMTAAPRLVLFTSEHSHYSIKKASAALGFGTENL
ILLSTDERGRVIPADLEAKVIDAKARGCVPMFVNATAGSTVYGAFDPIHEIADICEKYNM
WLHVDGAWGGGLLMSRKHRHKLSGVERANSVTWNPHKMMGVPLQCSAILVRERGVLSGCN
SMCAGYLFQPDKQYDVSYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFEQHIDKCLDLSH
YLYTKIKDRQGYQMVFEGEPQHTNVCFWYLPPGIRGMPDGQEKRERLHKVAPRIKAMMME
SGTTMVGYQPQGDKVNFFRMVISNPAATRSDIDFLTDEIERLGRDL
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtctgcaccttcctcctccaccggcgaaccggatcccaactcgacaaattta
cgaccacctggctcaagctatgacgcttggtgtggagttgctcatggatgtactagaaaa
ttgggaatgaagatatgtggatttttgcagaagaacaacaaccttgaggaaaagatcagt
tcactgaaggaaaaaccttccaaggatcttctggataacagcgacagggattcccgtttt
agacgcaccgagacagatttttccaatctgtatgctagagatttattaccagccaaaaat
ggtgaggaaccaaccatgcagttcctgctggaggtggtggatattctcacaaactatgtc
cgcaagaccttcgacagatccaccaaagtcctggactttcaccacccccaccagctgctg
gagggcatggagggtttcaacctggaactgtctgaccaacctgagtctctggagcagatc
ctggtggactgcagggatactctgaaatatggagtgagaacaggtcacccccgctttttc
aatcaactttctactggcttggacatcattggtttggcaggagaatggctcacctccact
gcaaacacaaatatgttcacctatgagatcgccccagtctttgtgctcatggagcagttg
acgctgaggaagatgagggagattattggctggccaaatggtgagggtgatgggatattt
tcaccaggtggagcaatatccaacatgtacagtgtgatgattgcccggtacaagttcttt
cctgaagtcaaggccaaaggcatgacagcagccccgagactggtactgttcacctcagag
cacagccactactctattaaaaaagccagtgctgctctgggctttggaacagaaaacctg
atcctgttgagcacagatgaaagagggagagtcattcctgctgatttggaagccaaggtc
atcgatgccaaggccaggggttgtgtgccaatgttcgtgaacgctacagctggctccaca
gtgtatggtgcattcgaccccatccatgagattgcagacatctgcgagaaatacaacatg
tggctacatgtggatggtgcatggggaggaggacttctgatgtccaggaagcacaggcac
aagctgagtggcgtagagagggctaactcagtcacctggaaccctcacaagatgatggga
gtgccactgcagtgctctgccatcctggtcagagagcggggtgtgttatcaggctgcaac
tctatgtgtgctggctacctcttccaacctgacaaacagtacgacgtgtcgtacgacaca
ggggacaaggccatccaatgtgggcgacatgtagatatcttcaaattctggcttatgtgg
aaagcaaagggaacggtggggtttgaacaacacatcgacaagtgcttggacctctcgcat
tatctctacaccaaaatcaaggaccgccagggctatcagatggtgttcgagggagagccc
cagcacacaaatgtttgcttctggtaccttccgccaggtattcggggcatgcctgatggt
caggagaagcgggagaggttgcacaaggtggcccccaggatcaaggccatgatgatggag
tctggaactaccatggttggataccagcctcagggggacaaggtcaacttcttccgcatg
gtcatctccaaccccgctgccacccgatcagatatcgacttcctgaccgacgagattgaa
agactggggcgggacctgtaa

DBGET integrated database retrieval system