KEGG   Esox lucius (northern pike): 105022773Help
Entry
105022773         CDS       T04894                                 

Gene name
hdac7
Definition
(RefSeq) histone deacetylase 7 isoform X1
  KO
K11408  histone deacetylase 7 [EC:3.5.1.98]
Organism
els  Esox lucius (northern pike)
Brite
KEGG Orthology (KO) [BR:els00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:els03036]
    105022773 (hdac7)
Enzymes [BR:els01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     105022773 (hdac7)
Chromosome and associated proteins [BR:els03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     105022773 (hdac7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 105022773
NCBI-ProteinID: XP_010889778
LinkDB All DBs
AA seq 958 aa AA seqDB search
MDLRVTERVMRPGSDTALLTPLHPPMLLRPFSPQPCTPFSQQQLQQHIRFNMEQRRREQE
QEKQQELQQLWHKDKSQQSAVASSLVKQKLQEVILKKQKQQAERTSSNPLSGPPVGYREL
APDPSGPAQPLVSPPPQISTDGSDETPLRRAASEPNLKVKHKLKKHLNTRKSPLTRKESA
PATIKHRLPDTLDSSPSSSSTPVSGCSSPNDSLPNENGVLPSAGGLSHEVIIRLAQRLLL
QDGSLSHFTIQSSSALPTITLGLPATARSDGDLSPLKVGRVVGGGQSVYLPLGMEEQTGS
LSPHLQPVLILEPGLVHPTMLAVPGLGTVPLQFAPQMDRMTPGGGLHKPLSRAQSEPLPQ
SPRPLHPHLLQQQHHHSHLLERLKQQTHLGKLMSKSSEKPRLRQIPSEDMDSEEAAPTHS
DTYQGRARAESLREAESVSVVDSQGEQVNLQHTLILNQSLLWEKQKQLQQLRRQTAHMET
LAVPMILGGAHRPLSRTQSSPASTSLTLPDKPLAIPGTEPQNKPRFTTGLVYDSQMLKHQ
CTCGDNSSHPEHAGRIQSIWSRLQERGLRAQCEVIRGRKATLEELQSVHSERHVLLYGTN
PLNRLKLDNRKLAGILSQRMFVMLPCGGVGVDNDTIWNESHTSTASRMAAGSVTELAFRV
AKGELKNGFAVVRPPGHHADPSNPMGFCYFNSVAIAAKQLQQKLSASKILIVDWDVHHGN
GTQEVFYNDPSVLYISLHRYDDGNFFPGSGGPAEVGSGAGEGFNINVAWTGGLEPPMSDA
EYIAAFRSVVMPIAQEFSPDVVLVSSGFDAAEGHPAPLGGYKVTAKCFGFLTRQLMGLAG
GRVIMALEGGHDLTAICDASEACVSALLGIEEPLSEEVLLQKPNANGVRSLQRVIQIHGQ
YWQSLKPFTSSVGLSYLGAQRRDCEETDAVNALASLSVGVLTSKSLPDEPMEHDEDCM
NT seq 2877 nt NT seq  +upstreamnt  +downstreamnt
atggacctgcgtgtgactgagcgtgtgatgaggccgggttcggacacggccctcctgacg
cctctgcacccccccatgctcctccggccgttctccccccagccctgcacccctttctca
cagcaacagctgcagcagcacatacggtttaacatggaacagcggagacgtgagcaggag
caagaaaaacaacaggagctacagcagctgtggcacaaggacaagagccaacagagtgct
gtggccagttccctggtcaagcagaagctccaggaggtcattctgaagaagcagaaacaa
caggccgagaggaccagctctaaccctctcagtggtccgcctgtgggctacagagaactg
gctccagaccccagtggaccagcccagcctctggtgtcccccccgccacagatctccact
gacggctcagacgagacccccctacgcagagctgcctctgaacccaacctgaaggtaaaa
cacaagctgaagaaacacctgaacacccgtaagagtcctctgacccgtaaggagagtgcc
ccggccactatcaaacaccggttaccggacaccctggactcgtcccccagcagcagtagt
accccagtgtctggctgcagctcgcctaacgacagtctacccaatgagaacggagtactg
ccctctgctggcgggctgtcccatgaggttattatccgattggctcaaaggcttctgctc
caggatgggtctctgtcccacttcaccatccagagttcctctgccctgcccaccatcacg
ctgggtctgcctgctactgccaggagtgatggagacttgtctcctctgaaggttggccgg
gtggtggggggaggccagtcggtctaccttcccctggggatggaggagcagactgggtcg
ctgtcgccccacctccagccagtcctcatcctggagcctggactggtacaccccacaatg
ctcgctgttccaggtcttggcactgtgccactgcagtttgcccctcagatggatcgaatg
accccaggagggggccttcacaagcccctgagtcgggctcagtcagagcccctgccccag
agccccagacctctacacccccacctgctacaacaacaacaccaccacagccatctcctg
gagaggcttaaacagcagacccacttgggcaagctgatgtcaaagtccagtgagaagcct
cgacttagacaaataccctcggaggacatggactctgaggaggcggctccaacgcacagt
gacacctatcagggcagagcacgggcggagtcactgagggaggcggagtctgtgtctgta
gtggatagccagggagaacaagtcaacctgcaacacacactcatactcaaccagtcattg
ctgtgggaaaaacagaaacagctgcaacagctgcgtcggcagacagcccacatggagacg
ttggcagtacccatgatcctcggtggtgcccaccgccccctctcccgtacccagtcctca
ccagcctctacatctctgacgttgccagacaaacccctggccattccaggcacagaacca
cagaacaaaccacgcttcaccactggcctggtttacgactctcagatgctgaagcatcag
tgtacatgcggcgacaacagcagccacccggagcacgctgggaggatccagagtatctgg
tctcgactccaggagagaggtctcagggcccagtgtgaggtcatccgtggcaggaaggcc
actctggaggagttgcagtcggtccattcagagcgccacgtcctgctgtacggcaccaat
ccgctcaaccgcctcaagctggacaaccgcaagctggctggcattctctctcaaagaatg
tttgtgatgcttccctgtggaggagtgggggtggacaacgacaccatctggaacgagtcc
catacatccacggcgtcacgcatggctgccggcagcgtcacggagctggccttcagagtg
gccaaaggagagctcaagaatggctttgcagtggtgaggccgccgggacaccacgccgac
ccctccaaccccatgggtttctgttatttcaactcggtggcgatcgcagccaagcaactc
caacagaagctcagtgccagcaagatcctcatcgttgactgggatgttcaccacggtaat
gggacccaggaagtgttttacaatgaccccagtgttctgtacatctcactgcatcgctat
gacgatggtaacttcttccctggcagcggggggccggctgaggtggggtctggtgctgga
gagggcttcaatattaacgtggcctggactggtggtctagaaccccccatgagtgatgct
gagtacatagctgcttttaggtcagtggtgatgcccatcgctcaggagttctccccggat
gtggtcctggtgtcctcagggttcgacgctgccgagggacaccctgcaccgctcgggggt
tacaaggtcacagccaaatgttttgggttcctgactcggcagctgatgggtctggctgga
ggccgggtgatcatggccctggaggggggtcatgacctcacagctatctgtgacgcctcc
gaggcctgtgttagcgctctactggggattgaggagcctctgtcagaggaggtgctgctg
cagaagcccaatgctaacggtgttcgctcactacaacgagtcatacagatacatggtcag
tactggcagtccctgaagccattcacctcgtccgtgggcctgtcctacctgggcgctcag
aggagagactgtgaggagactgatgctgtcaatgccctggcctccctctctgtaggggtc
ctgaccagcaagagcctacctgatgagcctatggagcatgacgaagactgcatgtag

DBGET integrated database retrieval system