KEGG   Esox lucius (northern pike): 105023097
Entry
105023097         CDS       T04894                                 

Gene name
cacna1c
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C isoform X1
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
els  Esox lucius (northern pike)
Pathway
els04010  MAPK signaling pathway
els04020  Calcium signaling pathway
els04260  Cardiac muscle contraction
els04261  Adrenergic signaling in cardiomyocytes
els04270  Vascular smooth muscle contraction
els04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105023097 (cacna1c)
   04020 Calcium signaling pathway
    105023097 (cacna1c)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    105023097 (cacna1c)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    105023097 (cacna1c)
   04261 Adrenergic signaling in cardiomyocytes
    105023097 (cacna1c)
   04270 Vascular smooth muscle contraction
    105023097 (cacna1c)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:els04040]
    105023097 (cacna1c)
Ion channels [BR:els04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   105023097 (cacna1c)
SSDB
Motif
Pfam: Ion_trans GPHH Ca_chan_IQ CAC1F_C PKD_channel
Other DBs
NCBI-GeneID: 105023097
NCBI-ProteinID: XP_028970319
LinkDB
AA seq 2311 aa
MLGRWFQRKPKHERLQEEPEVRAAKGTLVSEAEMGYTHVRPGGSDYPPPPLPAPAPSLND
TSAVVGGGGAAGVTALDTVVGGAVVGLAAEHIPSGPGAALTWQAAIEAARQAKQMGNAGA
PISTASSTQRKRQHYTTKPKKPTSTAATRPPRALLCLTLKNPIRRACISIVEWKPFEIII
LMTIFANCVALAVYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAY
LRNGWNLLDFIIVVVGLFSAILEQATKVDGGTPIGGKAAGFDVKALRAFRVLRPLRLVSG
VPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHRTCFFYREGYPYHRG
PMVEEKPAPCAPNGAHGRHCTQNSTQCMMGWEGPNDGITNFDNFAFAMLTVFQCITMEGW
TDVLYWMQDAMGYELPWAYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLR
EKQQLEEDLKGYLDWITQAEDIDPENEDEGLDDDKPRNRLTLADLLDKKKGKFAWFSHSS
ETHVSMPASENESVNTDNVPAGDMGGETCCTRLANRISKSKFSRYSRRWNRLCRRKCRAG
VKSNVFYWLVIFLVFLNTLTIASEHHKQPQWLTDTQDIANKVLLALFTGEMLLKMYSLGL
QAYFVSLFNRFDSFVVCGGILETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNL
VASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDETRRSTFDNFPQSLLTVFQI
LTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESL
TSAQKEEEEEKERKKLARTASPEKRHDNEKPPMIEVKEKKEEKIELKSITSDGETTNATK
INIDEYQVDENEEKNPYPANDFPGTTVPVLKREEDEEEPEMPVGPRPRPLSDIQLKEKAV
PMPEARAFFIFSNTNKFRVLCHKIVNHNIFTNLILFFILLSSISLAAEDPVKNNSPRNQI
LGYADYVFTGLFTIEIILKMTAYGAFIHKGSFCRNYFNILDLVVVSVSLISSGIQSSAIN
VVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTSLLQFMFACIGVQLFK
GKFSYCSDSSKSTEPECRGSYIMYKDGDVGKPQRSLRAWENSDFNFDDVLQGMMALFAVS
TFEGWPALLYRAIDSHSEDLGPVYNYRVVVSIFFIIYIIIIAFFMMNIFVGFVIVTFQEQ
GEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQYQYKVWYVVNSTYFEYLMFTLILLN
TICLAMQHHGQTKSFNDAMNILNMLFTGLFTVEMILKLIAFKPRGYFSDPWNVFDFLIVI
GSIIDVILSEINPADPASNSSQTSSGLQNSEDNARISITFFRLFRVMRLVKLLSRGEGIR
TLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQMFGKIALRDNSQINRNNNFQTFPQATL
LLFRCATGEAWQEIMLACAPNQTCEKGSEGASDDQCGSHFAIFYFVSFYMLCAFLIINLF
VAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFG
KLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTDGNLEQANEELRAIVKK
IWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVAKVPPKTALSL
QAGLRTLHDMGPEIRRAISGDLTVEEDLDKSIKEPVSAASEDDIFRRAGGLFGNHVSYYN
DGHEDGRSTFPQSFTTQRPLHISQTGSPGEGGSPSRQKLMDSTTFTPSSYSSSGSNANVN
NANNTGIPGLVVGPGGVSRFPSPSISTVDGLSRPPLTPILLPRPAWCFPPKRTCLYDSLI
RSDSTDSRMPIIRREEAMAEATYDESYVDDREYHHSNQDILTSDMLVYQDEENKQLAPME
EGEDVDERRHWQSPRRAFLCPTALGKTCLPKALGRRSSFHLECLRRQTGAEVTQKTVLPL
HLVHHQALAVAGLSPLLRRSHSPTLFARLCSTPPTSPTGRGGQASYQRVPSLRLEGTGPA
TGSYELNSSLPSVNCGSWHSDSNGNSPGTGHRAGTASHRAPRPVSLTVPSSVHLDTASLS
HGSAGSLVEAVLISEGLGRFAQDPSIIEVTKQELADACDMTIEEMENAADNILNGNSQPS
PNGNLVPYMHCNRDRAASLEAGLDERPGALLEGIQELLGATHLGQHGDPEDEEGLEVVEV
EHIGEEEVIGAVGRRNSSLMEDEDMECVTSL
NT seq 6936 nt   +upstreamnt  +downstreamnt
atgttggggaggtggttccagagaaaacccaaacatgagcgtctgcaggaggagcctgag
gtccgggcagccaaggggacactggtctcggaggctgagatggggtacacacatgtccgc
ccgggaggctccgactacccccccccaccgttgccggcgccggctcccagcctgaatgat
accagcgcggtggtcgggggaggcggtgctgccggcgtcactgccctggacacggtggtc
ggcggggcggtggtcgggctcgcggccgagcacatccccagcggcccgggggcggccctg
acctggcaggcggcgatagaggcggcgcgccaggccaagcagatgggcaacgccggcgcg
cccatctccacggcaagctccacgcagaggaagaggcagcactacaccaccaagcccaag
aagccgaccagcacggccgccaccaggcctcctagggccctgctctgcctgacgctcaag
aatcccatccggagggcctgcatcagtatcgtggagtggaaaccatttgaaataatcatt
ttgatgactatttttgctaactgcgtggccttagccgtctacatccccttcccagaggat
gactccaatgccaccaactcaaacctggagcgagtggagtatctgttcctcatcatcttc
acggtagaagcctttctgaaggtaatagcgtatggactgctcttccatcccaacgcttac
ctgaggaatggatggaacttgctggatttcatcatcgtggttgtggggctcttcagcgct
atattggagcaggccaccaaagtagatggaggtacacccattggagggaaggcggcgggc
tttgacgtaaaggctctccgggcattcagggtgctcaggccactcagactggtgtccgga
gtacccagccttcaggtggtgctgaactccatcatcaaggccatggtaccactgctccac
atcgccctgctggttctcttcgtcatcatcatctatgccatcatcggcctggagctgttc
atgggcaagatgcaccgtacctgcttcttctacagagaggggtacccctaccacaggggt
cccatggtggaggagaaacccgcgccctgcgctccgaacggggcccatggccgtcactgc
acccagaactcgacgcagtgcatgatgggttgggaggggcccaacgacggcatcacgaac
ttcgacaactttgccttcgccatgctgacggtgttccagtgtatcaccatggagggctgg
acagacgttctctactggatgcaagacgctatgggctatgaacttccctgggcctatttt
gtcagtctcgtcatctttggatcctttttcgttctaaatctggttctgggggtgttgagc
ggagagttttctaaggagagagagaaggccaaggcccgcggagacttccagaagctgagg
gagaagcagcagctggaggaggacctgaagggctacctggactggatcacccaggccgag
gacatcgacccggagaacgaggacgaaggcctcgatgacgacaagcccagaaaccgactg
accttggccgacttgctcgacaagaagaaggggaagtttgcttggtttagtcactccagt
gagacacatgtgagcatgccggccagtgagaacgagtccgtgaatacagacaatgtgcct
gctggagatatgggtggagagacgtgctgcacccgattagcaaatagaatctccaaatcc
aagttcagccggtactcgcggcggtggaaccggctgtgtcgccgtaagtgcagagcgggg
gtgaagtccaacgtgttctactggctggtcatcttcctggtcttcctcaacaccctgacg
atcgcgtcagaacatcacaaacagcctcagtggctcacggacacccaagacatagccaac
aaggtcttgctggccctgttcacgggggagatgctgttaaagatgtacagcctgggcctg
caagcctacttcgtgtccttgttcaaccgtttcgacagcttcgtggtgtgtggcggcatc
ctggagaccatcctggtggagaccaagatcatgtccccgctcggcatctccgtcctccgc
tgcgtgcgtctgctgcgcatcttcaagatcacaaggtactggaactccctcagcaacctg
gtggcgtcgttgctcaactccgttcgctcaatcgcctccctgttgctgctgctcttcctc
ttcatcatcatcttcagcctgctcggcatgcagctcttcggaggcaagttcaactttgac
gagacgcggcggtcaaccttcgataactttccccagtcacttctcaccgtgtttcagatc
ctgacgggtgaggactggaactctgtgatgtatgatggtatcatggcgtacggaggaccc
tccttcccagggatgttggtctgcatctacttcatcatcctcttcatctgtggaaactac
attctcctaaatgtcttcttggccattgccgtggacaacctggctgatgctgagagccta
acctctgcccagaaggaggaagaggaggagaaggagaggaagaagcttgcacgaacggct
agcccagagaaacgacatgacaacgaaaagcctcccatgatcgaggtaaaggagaaaaaa
gaggagaagattgaactgaagtccatcacctccgatggagagaccaccaacgccaccaag
attaacattgacgagtaccaagtggacgagaatgaagaaaagaacccgtatccagccaat
gattttccaggtaccacagtaccggtgttgaaaagggaggaggacgaggaggagcctgag
atgccggtgggtccccggccacgccccctgtcagacatccagctgaaggagaaggctgtg
cccatgccggaggcccgggcgttcttcatcttcagcaacaccaataaattcagggttctg
tgccataagatcgtcaaccacaacatcttcaccaacctcatcctattcttcatcctcttg
agcagcatctctttggctgcagaggaccctgtcaagaacaactcccctaggaaccagatc
ctgggctatgcagactacgtcttcacaggcctcttcaccatagagatcattctaaagatg
acagcgtatggggcgttcatacataagggctcgttctgtcggaactacttcaacatcctg
gacctggtggttgtcagcgtgtcgctcatctcttcaggaatccagtccagtgccattaac
gtggtgaagattctccgggttctcagggtgctgaggcctctgagggccattaaccgggcc
aagggcctcaaacacgtggtccagtgtgtgtttgtggccatccgaaccatcggaaacatt
gtgatcgtcacctcccttctgcagttcatgttcgcctgcatcggagtgcagctcttcaag
ggaaagttctcctactgctctgacagttccaagtctacagagcccgagtgcaggggttcc
tacataatgtacaaggatggtgacgtggggaagcctcagagatctttgcgggcctgggag
aacagcgacttcaacttcgacgacgttctccaagggatgatggctctgttcgctgtgtcc
acctttgaaggatggccagcgctgctgtaccgggctatagactcccactcggaagacctt
ggccccgtctacaactacagagtggtggtgtccatcttcttcataatctacatcatcatc
atcgccttcttcatgatgaacatcttcgtcggtttcgtcattgtcacttttcaggagcaa
ggagagcaggagtacaagaactgtgagctggacaagaaccagcgtcagtgtgtggagtac
gccctgaaggcccgtccgttaaggagatacatccctaagaaccagtaccagtacaaggtg
tggtacgtagtcaactccacctacttcgagtacctgatgttcacactcatcctgctcaac
accatctgtctggctatgcagcaccatggccagaccaagtcatttaacgatgccatgaat
atcctcaacatgctcttcaccggtcttttcactgtcgagatgatcctcaaactcatcgcc
tttaaacctcggggttactttagtgatccttggaatgtttttgacttcctcatcgtaatt
ggcagcataatagacgtcattctgagtgagatcaacccagctgaccctgccagcaactcc
tcccaaacctcctcgggactacagaactcagaagacaacgcccggatctcaatcacgttc
ttccgtctcttccgagtgatgcggctggtcaaactgctgtcccggggagaaggcatcaga
accctgctctggacattcatcaagtcttttcaggccctcccctatgtagctctacttata
gtcatgctgttcttcatctatgctgtcatcgggatgcagatgttcggtaaaatagccctg
agggacaacagtcagatcaacagaaacaacaacttccagacctttcctcaggccacgttg
cttctcttcaggtgtgccactggcgaagcgtggcaagagatcatgctggcgtgcgccccc
aatcaaacctgtgagaagggctctgagggagccagcgatgaccagtgtgggagtcacttc
gccatcttctacttcgtcagcttctacatgctctgtgccttcctgattatcaatctgttt
gtggctgtgatcatggataactttgactacctgaccagagactggtccatcctgggaccg
catcacctggacgagttcaagaggatctgggctgaatacgacccggaggccaagggtcgt
atcaagcacctggacgtggtgactctgctgaggaggatccagccgccgcttggcttcggg
aagctctgtccccatcgggttgcctgtaaacgcctggtgtccatgaacatgcccctgaac
agcgatggcacggtcatgttcaacgccactctgtttgccctggtgcgaactgccctgagg
atcaaaactgatggtaacctggagcaggcaaacgaggagcttcgtgcaatagtgaagaag
atctggaaaaggaccagcatgaagcttctcgatcaggttgtgccccctgctggtgacgat
gaggtgactgttgggaagttctacgccacgttcctaatccaggagtacttcaggaaattt
aagaagcgtaaggaacaaggactagtggccaaagtacctcccaagactgctctctccctg
caggcgggcctacggacactccatgacatgggtcctgagatccgacgggcgatatcaggc
gacctgacggtggaggaggacctggacaagtctattaaagagccggtctctgctgcctcg
gaagacgatatctttaggagagcgggagggttgttcgggaaccacgtcagttactataac
gacgggcatgaagacggacggagcaccttcccccagtccttcaccacccagcggccgctc
cacatcagccagaccggcagcccaggggaaggggggtcgccgtcccgccagaagctaatg
gactccaccaccttcacgccgagctcctactcgtcgtcgggctccaacgccaacgtcaac
aacgccaacaacaccgggatcccgggactggtggtcggcccggggggcgtcagtcgcttc
cccagccccagtatcagtacggtcgacgggctgagcagaccaccgctcaccccaatacta
ctgccaaggcccgcttggtgcttccctcccaagaggacgtgtctctatgactccctcatc
cgctcggactccactgacagccgtatgccaatcatcaggcgagaggaggcaatggcagag
gcgacgtacgacgaaagttatgtcgacgacagagagtatcaccacagcaaccaggatata
ctcacctcagacatgctggtataccaggatgaggagaacaagcagttggctcctatggag
gaaggagaggacgtggatgagaggagacactggcagtctcccagaagagccttcctctgc
cccacagcactgggtaagacctgcctgcctaaagcactgggtcggaggtcgtccttccac
ctggagtgtctgaggagacagaccggagcagaggtcacccagaagacagtattacctcta
cacttggtccaccatcaggccctagctgtagcaggcctgagcccgctgcttcgacggagc
cactccccgacgctcttcgcgcggctctgctccacgccgcccaccagccccactggccga
ggtggccaggcgtcctaccagcgtgtgccgtcactgcgcctggagggcacgggtccagcc
accggctcctacgagctcaactccagcctgccctcggtcaactgcgggtcgtggcacagc
gacagcaacgggaacagcccgggcaccggccacagggcgggaacggcaagtcacagggcg
ccgcggcccgtttccctcacggtgccgagctctgtgcacctggacacggcgtcgttgtcc
cacggcagcgccgggagtttggtggaagcggtgctgatatcggagggcctgggtcgtttt
gcccaagacccctctattattgaggtgaccaagcaggaactggcagacgcgtgcgatatg
accatcgaggagatggagaacgccgccgacaacatactcaacggcaacagccagcccagc
cccaacgggaaccttgttccctacatgcactgcaacagggaccgtgccgctagcctggag
gccggcctcgacgagaggcccggggccctcctggaggggatccaggagctgctcggggcc
actcacctggggcagcacggggatccggaggacgaggaggggctggaggtggtggaggtg
gagcacattggggaggaggaggtgataggggcggtggggcggaggaacagcagcctgatg
gaggatgaggacatggagtgtgtgaccagtttgtag

DBGET integrated database retrieval system