KEGG   Esox lucius (northern pike): 105023306Help
Entry
105023306         CDS       T04894                                 

Gene name
enpep
Definition
(RefSeq) glutamyl aminopeptidase
  KO
K11141  glutamyl aminopeptidase [EC:3.4.11.7]
Organism
els  Esox lucius (northern pike)
Brite
KEGG Orthology (KO) [BR:els00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:els01002]
    105023306 (enpep)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:els04147]
    105023306 (enpep)
   04090 CD molecules [BR:els04090]
    105023306 (enpep)
Enzymes [BR:els01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.7  glutamyl aminopeptidase
     105023306 (enpep)
Peptidases and inhibitors [BR:els01002]
 Metallo peptidases
  Family M1
   105023306 (enpep)
Exosome [BR:els04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   105023306 (enpep)
CD molecules [BR:els04090]
 Proteins
  105023306 (enpep)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N DUF4954 DUF1570
Motif
Other DBs
NCBI-GeneID: 105023306
NCBI-ProteinID: XP_010890698
UniProt: A0A3P8YBP2
LinkDB All DBs
AA seq 961 aa AA seqDB search
MVESMEFEKEEKSYCIQGKHVATICAVVVLSAVAVGLGVGLTRQDCILANPPPTEEPPKP
TATSPPPVDRGPCKPSNNTDGDWKNFRLPDYVKPLHYDLHLDPDLTTDLYMGSVSVHLEV
TRATKHLWLHIRETFVSAVPTLVLKTSQAQRDKIVNIKGCFEFKPQEYVVVEAAEELVPT
KPGEVYILSLNFQGWLNGSLVGFYRVTYTENGATKKIAATDHEPTDARKSFPCFDEPNKK
ATYNISITHNEDYEAISNMPVEGSPERISNRKIKTSFQRSVLMSTYLVCFAVHQFTFVNR
TSSRGIPLRIYAQPSQIGTAEYAANMTVVIFDFFEEYFNMNYSIPKLDMIAIPDFGTGAM
ENWGLITYREANLLYDENQSSSHNKQRVASVIAHELVHQWFGNIVTMDWWDDLWLNEGFA
SFFEYIGVEKAEPSWGMRDIMIISDVLPVMVDDALVTSHPIIVNVSTPAEITSVFDGISY
SKGASLLRMVEDWLGKDIFRDGCRKYLNNFRFDNAKTDDFWESLANVSGLPVADVMDTWT
KQMGYPVLNLSTDENLTKLTQQRFLLDPNADPTQPTSPVSYKWTIPVKWHSLDSNKNMLI
MFNKSSPEIVLDYSLDTDGLLKVNNDHIGFYRVNHHESMWSTISQKLQTNHQEFDAADRC
SYIDDVFALARADITDYGIAFNLTKYLSNETEYIIWERVSSSIDYVRDMLSDDTVLYPKF
QKIFHDYVRNIARQMGWVDQGSQRNRLLRETVLGIACQMGDIEQLNEASAIFDKWIAGNI
SVGVNLRLLVYRYGMKNSGTEKKWNIMFERYKTETLAQEKDKLLYGLASVENTTLLNNLL
EASKDESIVRSQDLFTVVRYVSLNRYGKTMAWDWVTLNWDYLVNKYTINDRNLGRLLTRI
STTYNTEPQLWQMEHFFKLNPNAGAGEMPRQQALETVKNNIEWVRRNKAEISLWLGSNIP
L
NT seq 2886 nt NT seq  +upstreamnt  +downstreamnt
atggtggaaagcatggagtttgagaaggaggagaagagctattgcatccagggaaagcat
gtagccactatctgtgctgtggtagtgctatcggctgtagctgtggggctgggggtgggc
ctcacacgacaagactgcatcttagctaacccacccccgacagaggaaccccccaagcca
accgccacttcacccccaccagtcgacaggggcccctgcaagccctctaacaacactgat
ggtgactggaagaatttccgtctgcctgactacgtgaagccattgcactatgacctccat
ctggatcctgacctgaccactgacctctatatggggagcgtgtccgtgcacctggaggtg
accagagcgacgaagcacctttggcttcacatccgggagacatttgtcagtgcagtcccg
acgcttgtcctgaaaacatcacaggctcaaagggacaagatcgtaaacatcaagggttgt
tttgaattcaaacctcaggagtatgtagtagtggaggcggcagaggaacttgtgcccacc
aagcctggggaggtgtatattctcagcctgaatttccaaggctggctcaatggatctctg
gtgggcttctacagagtcacctacacagagaatggggccaccaaaaaaattgctgccacc
gaccatgaaccaacagatgcccggaaatctttcccttgttttgatgagccaaacaaaaag
gccacctacaacatctccattacccacaatgaagactatgaagccatctccaatatgcca
gtggagggcagccccgaacggatatctaaccgcaaaatcaaaacatccttccagaggtct
gttctaatgagtacctatttggtatgttttgctgtgcaccagtttacatttgtgaacagg
acatcgtctagaggaattcctttgcgaatttatgcacaaccttcacaaatcgggacagcg
gagtatgctgctaacatgactgtggtcatttttgacttctttgaggaatatttcaacatg
aattactccattcctaagttagatatgattgctatccctgactttggaactggagccatg
gagaactggggcctgatcacttacagggaggccaacctcctttatgacgaaaaccagtct
tcatcacacaacaaacaacgtgtggctagcgtcatagctcatgagctggtccaccagtgg
tttgggaacattgtgaccatggattggtgggatgacctttggctgaatgagggctttgcc
agtttctttgagtacattggtgtagagaaggctgagccctcctggggaatgcgtgacatt
atgatcatcagtgatgtgcttcctgtcatggtagacgatgcgcttgtcacctcccatcca
atcattgtgaatgtgtcaaccccggctgagattacctcagtgtttgatggtatttcctac
agcaagggggcatcacttcttagaatggttgaggactggttgggtaaagacatatttagg
gatggctgtcggaaatacttaaacaattttcggtttgataatgccaaaactgatgacttt
tgggaatcccttgctaacgttagtgggttgcccgtggcagatgtgatggacacatggacc
aaacagatgggctacccagtactcaacctgtctaccgatgaaaatctgaccaaactcacc
cagcaaaggtttctcttggaccctaatgcagatcccactcagccaacttctccagtcagc
tacaagtggacaatccctgttaagtggcactcactggacagcaacaagaatatgcttatc
atgttcaacaagtccagtccagagatagtcttagactattcccttgacacggatggactc
ctgaaggtcaacaatgaccacattggtttctacagagtcaatcaccatgaaagcatgtgg
agcaccattagtcaaaagctccaaacgaatcaccaggagtttgatgctgcagatcgatgc
agttatattgatgatgtctttgctctagcacgggctgacattactgattatggaattgca
ttcaacctgacaaagtacctgagcaatgagactgagtacatcatctgggaacgtgtttct
tcttctatcgactatgtgcgagatatgttatcagacgacactgttctttatcccaagttc
cagaaaattttccatgactatgtacgcaatatagccaggcaaatgggatgggttgatcag
ggaagccagagaaacaggctgctgcgtgaaacagtcctaggaattgcttgtcaaatgggt
gacatagaacagctaaacgaggcgtctgccatctttgacaaatggattgcaggaaatatc
agtgtaggggtgaacctgcgcctgcttgtgtatcgctatggcatgaaaaactcaggcact
gagaagaagtggaacataatgtttgagaggtacaaaacagagaccttggctcaagagaag
gacaagctcctgtatggattagcatctgtggaaaacacaactcttctaaacaacttgctt
gaggcgtcaaaagatgagagtattgtgaggagtcaagatctgtttactgtggtccgctat
gtttctttgaatcgctatggcaagactatggcctgggactgggtcaccctcaactgggac
tacctagtgaacaaatacaccatcaatgacagaaacctggggcgcctgcttaccagaatc
agtaccacctacaacacagagccacaactctggcagatggaacactttttcaagctgaac
cccaatgctggggctggtgagatgcctagacagcaagctctagagacagtgaagaacaac
attgagtgggtcagaagaaacaaagcagagatcagtttatggctggggagcaatatcccc
ttataa

DBGET integrated database retrieval system