KEGG   Esox lucius (northern pike): 105023381
Entry
105023381         CDS       T04894                                 

Gene name
lpar2
Definition
(RefSeq) lysophosphatidic acid receptor 2
  KO
K04291  lysophosphatidic acid receptor 2
Organism
els  Esox lucius (northern pike)
Pathway
els04080  Neuroactive ligand-receptor interaction
els04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    105023381 (lpar2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    105023381 (lpar2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:els04030]
    105023381 (lpar2)
G protein-coupled receptors [BR:els04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    105023381 (lpar2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4
Other DBs
NCBI-GeneID: 105023381
NCBI-ProteinID: XP_010890829
UniProt: A0A3P8ZX26
LinkDB
AA seq 368 aa
MEIDSRVARNACDYGRNITFFYEYVGKEISRDWGIRECIIVGVGLPICLLMVLSNVMVMV
AIKVNQRFHFPIYYLMANMAAADLFAGLAYTNLMLNTGPWTSRLTKQQWFIRNALVDISL
TASVANLLAVAVERHQTVMTMQLHNKMTNRRVVLLIVFIWILAIVMGLVPSMGWNCQCQL
SDCSTIAPLYSRKYLIFWASLNLLTFSFMVAVYARILVYVRRKSRRMSRHSVYPRAHSET
VVNLMKTISIVLGVFVLCWTPGLVTLLLDGIMGKESHAAAYEKYCLILAECNSLVNPLIY
TYRDKEMRRTFKCILGFLCRRSCDHQGESSPVEADTLQPKSPQVEDISEIEVEDQATGGS
CQLIERKW
NT seq 1107 nt   +upstreamnt  +downstreamnt
atggagatcgacagcagggtcgcgaggaacgcgtgcgactacggtcgcaacatcaccttc
ttctacgagtacgtgggcaaggaaatcagcagagactggggaatccgggaatgcatcatc
gtgggtgtgggtctgccgatctgcctcctcatggtcctgtccaatgtcatggtgatggtc
gccatcaaggtcaaccagcgcttccacttccccatctactacctgatggccaacatggcg
gcagcagacttgttcgccgggttggcttacaccaacctcatgctgaacaccggaccctgg
acgagcagactgaccaaacagcagtggttcatcaggaatgccctggtggatattagcctg
actgcatctgtggccaacctgttggccgttgcggtggaacgccaccagaccgtcatgacc
atgcagctgcacaacaagatgaccaacaggcgcgtggtgctgctcatcgtgttcatctgg
atcctggctatcgtcatgggtctggtgccgtccatgggttggaactgccagtgccagctc
agcgactgctccaccatcgccccgctctacagccgcaagtatctgatcttctgggcgtct
ctcaacctcctcaccttttctttcatggtggccgtgtacgcacgcatccttgtatacgtg
aggcggaagagccgacggatgtcccggcacagcgtctacccacgggcccatagtgagacc
gtggtcaacctcatgaagactatatccatagtactgggtgtgtttgtcttgtgttggacc
ccaggccttgtgactctgttgttggatggaataatgggtaaagaaagtcatgcagcggcc
tatgaaaagtactgcctgatccttgccgagtgtaactccttggtcaacccgcttatctac
acctaccgggacaaggagatgaggaggactttcaagtgtatcctaggcttcctatgtagg
agaagctgtgaccaccagggggagtcgtcccctgtggaggctgacacgctacagcctaag
tcaccacaggtggaggacatctctgagatcgaagtagaggaccaagccactggtggttct
tgtcagctgatcgagagaaagtggtga

DBGET integrated database retrieval system