KEGG   Esox lucius (northern pike): 105023521
Entry
105023521         CDS       T04894                                 

Gene name
tgfbr2
Definition
(RefSeq) TGF-beta receptor type-2
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
els  Esox lucius (northern pike)
Pathway
els04010  MAPK signaling pathway
els04060  Cytokine-cytokine receptor interaction
els04068  FoxO signaling pathway
els04144  Endocytosis
els04218  Cellular senescence
els04350  TGF-beta signaling pathway
els04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105023521 (tgfbr2)
   04350 TGF-beta signaling pathway
    105023521 (tgfbr2)
   04068 FoxO signaling pathway
    105023521 (tgfbr2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    105023521 (tgfbr2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    105023521 (tgfbr2)
  09143 Cell growth and death
   04218 Cellular senescence
    105023521 (tgfbr2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    105023521 (tgfbr2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:els01001]
    105023521 (tgfbr2)
Enzymes [BR:els01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     105023521 (tgfbr2)
Protein kinases [BR:els01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   105023521 (tgfbr2)
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase Pkinase_fungal
Other DBs
NCBI-GeneID: 105023521
NCBI-ProteinID: XP_028969352
LinkDB
AA seq 588 aa
MEGFGLFLLRWGTVPFLFIAVLEPSRVGGMFTQPYVLSRLCKFCDLEPSSCNGMGTCSSN
CSITSICTHHQEVCVSIWRRNESNYSIETLCHNPFLPLYGVELDDYNASTCTMKEKNSST
GLIYVCSCTEEECNDVLVFSPAVSPTIISTVVSVLLVSLLPLLVLAVLVVAVFYWYRVYR
QHRLNQEQWVTRKPKRKVKGLDCSDACAIMMDDDGSDSSSTHANNLNHNTELLPIELDLQ
VGKGRFAEVYKAKLRQPGSSSDQFETVAVKIFPDEEYASWKNEKDIFSDIDLRHENVLHF
LTAEERKLSKQYWLITAFHPGGNLQEYLTRHLVSWEDLRSLGGSLACGVAHLHSDHTACG
RPKVPIVHRDLKSSNVLVKQDLTCCLCDFGLGLRLDNTLTVDDLANSGQVGTARYMAPEV
LESRLNLENIESFKQTDVYSMALVLWEITSRCHAIGEVKDYEPPYGSKVQVHPGVESMKD
HLLRDRGRPDIPDSWINHQGISIVCATIEECWDHDPEARLTAQCVAERFADIECEMDKLS
SRSSSDEKIPAEEPKTVTAAEDREQIILEEEEKEEEKVPVESSVSNEQ
NT seq 1767 nt   +upstreamnt  +downstreamnt
atggagggatttggattgttcttacttcgctggggcacggtacctttcctattcatagcc
gttctggaaccaagcagagttggcggcatgttcactcaaccgtacgttctgagtaggctg
tgtaagttctgtgacctggagccctcctcctgtaacgggatgggaacatgctcctccaac
tgctccatcacctccatctgtacgcatcaccaggaggtgtgtgtcagcatctggaggaga
aatgaaagcaactacagcattgagactctgtgccacaaccccttcctccccctgtatggc
gttgagttggatgactacaatgcttccacttgcaccatgaaggagaagaacagctcaacg
ggactgatctatgtgtgctcctgcactgaggaggagtgcaacgatgtcctcgttttttca
cccgcggtgagtccaaccatcatttccactgtggtctcggttctcctggtttctctgttg
ccgctcctggtcctcgccgttttggtcgtcgctgtgttctactggtacagagtctaccga
caacacagactcaaccaggaacagtgggtcaccaggaagcccaagcgaaaggtcaaaggt
ctagactgcagcgatgcgtgcgccatcatgatggatgatgacggctcggacagcagctcg
acccacgccaacaaccttaaccacaacaccgaactgctacccatagaactggacctgcag
gtgggtaaggggcgattcgctgaggtgtacaaagccaagctgagacagcctggatcctcg
tcagaccagttcgagactgtggccgtcaagatctttccagatgaagagtatgcgtcgtgg
aagaacgagaaggacatcttttctgacattgatcttcgtcacgaaaacgtcctccacttc
ctcacagcagaggagcgtaagctgtcgaagcagtactggctgatcacggccttccaccct
gggggaaacctccaggagtacctgacccgccacctggtctcttgggaggacctaaggagt
ctgggaggatccctggcttgcggtgtggcccacctccacagtgaccacacggcctgcggg
cgacccaaggtgcccatagtgcacagggacctgaagagctccaatgtcctggtgaaacag
gacctcacctgctgtctctgcgactttggcctggggctcaggctggacaacactctgact
gtggatgacctggccaacagcggacaggtgggcacagccaggtacatggctccggaggtg
ctggagtccaggttgaacctggagaacatcgagtcgttcaaacagacagatgtctactca
atggctttggtgctgtgggagatcacctcccgctgtcacgctattggagaagtgaaggat
tacgagcctccatatggctcaaaggtccaggtgcacccgggtgtggagagtatgaaggac
cacctcttgagagacaggggaagacctgacattcctgacagctggatcaaccaccagggc
atatccatcgtgtgcgccaccattgaggagtgctgggaccacgacccagaggccaggctc
accgcccagtgtgtggctgagcgctttgctgacatagagtgtgaaatggacaagctgtcc
agccggagcagctctgacgagaagataccagcggaagagccgaagaccgtgacggcggcg
gaggatcgagaacagatcattttagaggaggaagagaaagaggaggagaaggtacctgtg
gagagctctgtgagcaacgagcagtga

DBGET integrated database retrieval system