KEGG   Esox lucius (northern pike): 105023842Help
Entry
105023842         CDS       T04894                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, muscle type
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
els  Esox lucius (northern pike)
Pathway
els00010  Glycolysis / Gluconeogenesis
els00030  Pentose phosphate pathway
els00051  Fructose and mannose metabolism
els00052  Galactose metabolism
els01100  Metabolic pathways
els01200  Carbon metabolism
els01230  Biosynthesis of amino acids
els03018  RNA degradation
Module
els_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:els00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    105023842
   00030 Pentose phosphate pathway
    105023842
   00051 Fructose and mannose metabolism
    105023842
   00052 Galactose metabolism
    105023842
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    105023842
Enzymes [BR:els01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     105023842
Protein phosphatases and associated proteins [BR:els01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     105023842
Messenger RNA biogenesis [BR:els03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     105023842
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 105023842
NCBI-ProteinID: XP_010891642
LinkDB All DBs
AA seq 781 aa AA seqDB search
MSHTSMDPTKMGVGRSIAVLTSGGDAQGMNAAVRATVRVGLYTGAKVYFVHEGYQGLVDG
GDNIRPATWESVSMMLQLGGTVIGSARCMDFRGREGRTKAALNLVKLGITNLCVIGGDGS
LTGANQFRTEWSTLLIDLLKAGKITKEEAKRSSHLNIVGMVGSIDNDFCGTDMTIGTDSA
LHRIIEVVDAITTTAQSHQRTFILEVMGRHCGYLALVTALSCGADWVFVPEMPPEEGWEE
HLCRRLANQRARGCRLNVIIVAEGAMSRDGNAISSEDIKKLVEKSLGFDTRTTVLGHVQR
GGTPSAFDRILGSRMGVEAVMALLEATPETPACVVSLSGNQAVRLPLMECVQVTKDVTTA
MAERRWEDAIKLRGKSFENNWNTYKMLAHINPPDTKSNINVAILNVGAPCAGMNAAVRSA
VRIGIIQGHNMLAVHDGFEGLAHGNIEPITWTGVSGWTGKGGSQLGTKRVLPSKYIEEIS
LTIAKFNIHSLVIIGGFEAYVGGLELVTAREKYEELCIPMVVIPATVSNNVPGSDFSIGA
DTALNTITSTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAAGADAAYIYEDKFSI
RDLETNVEHLVQKMKTDVKRGLILRNENCNANYTTDFIFALYSEEGKGVFDCRKNILGHM
QQGGTPTPFDRNFGTKMGSKAVLWITEKLKEVYRHGRIFANTPDSACLLGMRKRALTFQP
LADLKDQTDFEHRIPKTSWWLKLRPIMKILAKYNIPLDTSEHAHMEHVIKKKLSVPEPLM
K
NT seq 2346 nt NT seq  +upstreamnt  +downstreamnt
atgtcacatacaagcatggatccaactaagatgggcgtcggccggtctatagccgtgctg
acctcagggggtgatgcccaaggaatgaacgcggctgtgagggccacagtcagagttggc
ctctacactggagccaaggtctacttcgttcatgagggctaccagggcctggtggacgga
ggagacaacatccgaccggcaacctgggagagtgtgtccatgatgctgcagctgggcggc
acggtcatcggcagtgcccgttgcatggacttcagaggcagggagggccgcacaaaggct
gccctgaacctggtcaaactgggcatcaccaacctgtgtgtgattggcggtgacggcagt
ctgaccggagctaaccagttcaggacggagtggtccactttgcttatcgacctgcttaaa
gccggcaagatcactaaggaggaggccaagaggtcgtcccacctgaacatcgtaggaatg
gtggggtctatcgacaacgacttctgtggcacggacatgaccatcgggaccgactccgcg
ctgcatcgcatcatagaggtggtggacgccatcaccactacagcacagagccaccagcgg
accttcattctggaggtgatgggtcggcactgcggttacctggccctggtgaccgctcta
tcctgcggtgctgactgggtgttcgtcccagagatgcccccggaagagggatgggaggag
catctgtgcagaagactggccaatcaaagagccagagggtgtcgtctgaatgtgatcatt
gtggctgaaggagctatgagcagagatggaaatgccatcagctctgaagacatcaagaag
ctcgtggagaagtcattaggctttgacacccgtaccactgtcctgggtcacgtgcagagg
ggaggcacaccttcagccttcgacagaatcctgggcagcaggatgggtgtggaggctgtg
atggccctgcttgaagccactccagagaccccggcatgtgtggtcagtctgtctgggaac
caggctgtcaggctgcccttgatggagtgtgtccaggtgactaaggatgtgactactgcc
atggctgagaggagatgggaggatgcaatcaagctgagaggaaagagctttgaaaacaac
tggaacacatacaagatgctagcacacatcaaccctcctgataccaagagcaacattaac
gtggccatactcaacgtcggtgccccctgtgccggtatgaacgcagcggttcgttctgcg
gtgcggattggcatcattcagggacacaacatgctggccgttcatgatgggtttgagggg
ctcgctcacgggaacattgagccaattacctggactggagtgtctggctggactgggaag
ggcggctctcagctgggtaccaagagagtcctaccttctaagtacattgaggaaattagc
ttgacgattgcgaagttcaatatccactccctggtgatcattggagggtttgaggcgtat
gtgggcgggctggagctggtgacggccagggagaagtatgaggagctctgcatccccatg
gtggtcatccctgccaccgtctccaacaatgtccccggctccgacttcagcatcggtgct
gacaccgccctcaacaccatcacctcgacctgtgaccggatcaagcagtccgcggccggc
accaagcgtcgtgtattcatcattgagaccatggggggctactgtggctacctggctacc
atggccggtctggctgcgggggcggatgctgcttacatctacgaggacaagttctccatc
agagacctggagacaaatgtggaacatcttgtgcagaagatgaagaccgatgtaaagaga
ggtttgattctcaggaacgagaactgcaatgccaactacaccacagacttcatctttgcc
ctctactctgaggagggcaagggtgtcttcgactgccgtaagaacatcctgggacacatg
cagcaggggggtacaccaacacctttcgacaggaactttggcaccaagatgggatccaag
gctgttctgtggatcacagagaaactcaaggaggtctacagacatggtcgtatcttcgct
aacacccctgactcggcctgtttgttagggatgaggaagagagctctgaccttccagcct
ctggctgatttgaaggaccagactgactttgagcatcgcatccccaagacatcctggtgg
ctgaagctgagacccatcatgaagatcctggccaagtacaacatccccctggacacatct
gagcatgcccacatggagcacgtgatcaagaagaagttgtctgtgcccgagccacttatg
aagtag

DBGET integrated database retrieval system