KEGG   Esox lucius (northern pike): 105023937
Entry
105023937         CDS       T04894                                 

Definition
(RefSeq) arrestin red cell isoform X1
  KO
K04439  beta-arrestin
Organism
els  Esox lucius (northern pike)
Pathway
els04010  MAPK signaling pathway
els04144  Endocytosis
els04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105023937
   04340 Hedgehog signaling pathway
    105023937
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    105023937
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:els04131]
    105023937
Membrane trafficking [BR:els04131]
 Endocytosis
  Clathrin-mediated endocytosis
   GPCR adaptor proteins
    105023937
SSDB
Motif
Pfam: Arrestin_N Arrestin_C CBM_3
Other DBs
NCBI-GeneID: 105023937
NCBI-ProteinID: XP_010891791
UniProt: A0A3P8ZL11
LinkDB
AA seq 407 aa
MGDKAGTRVFKKSSPNCKVTVYLGKRDFVDHLDQVDPVDGVILVDPEYLKDRKVFVTLTC
AFRYGREDLDVLGLSFRKDLYISTFQAFPPIAEERKANSRLQERLLKKLGQQAHPFYFTI
PQNLPCSVTLQPGPEDTGKACGVDFEIRAFCAKSIEEKIHKRNSVRLVIRKVQYAPEKPG
PQPMVETTRSFLMSDRSLHLEASLDKELYYHGEPISVNVHVTNNSTKTVKRVKISVRQYA
DICLFSTAQYKCPVAQLEADDQVSSSSTFCKVYTLTPTLDKNREKRGLALDGKLKHEDTN
LASSTIVKDVTNKEVLGILVSYRVKVKLVISRGGDVSVELPFVLMHPKPTEPPTSRPQST
VPESDPPIDTNLIEFETNSFSQDDDFVFEDFARLRLKGMADDKDEDC
NT seq 1224 nt   +upstreamnt  +downstreamnt
atgggggacaaggcgggtactagagtcttcaagaagtcaagccccaactgcaaggtcacc
gtatacctgggaaagagagactttgtggatcaccttgaccaggtggacccagttgatggt
gtgattttagtggaccctgagtatcttaaagacaggaaagtgtttgtgacgctgacgtgt
gcgttccgctatggacgtgaggacctggatgtgctgggtttgtccttccggaaggatctc
tacatctccaccttccaggccttccccccaatcgcagaggaacgcaaagccaacagccgc
ctgcaggagcgactgttgaagaaacttggccagcaggcacatcccttctatttcactatt
ccccagaacctaccatgctccgtcaccttacagccaggaccagaagacaccggaaaggca
tgtggggtagactttgagatcagagctttctgtgccaaatcaatagaggagaagattcac
aagcggaactctgtacggctggttatccgtaaggtgcagtatgccccagagaagccaggg
cctcagcccatggtggagaccacacgtagcttcctcatgtcagaccgctcgttacacctg
gaggcctccctggataaagagctgtactaccatggagaacctatcagtgtgaatgttcac
gtcaccaacaactccaccaagactgtcaaaagagtcaaaatctcagtgcgacagtatgct
gacatctgtctgttcagtacagctcagtacaagtgtccagtggctcagctagaggctgat
gaccaggtgtcatccagctctacgttctgtaaggtgtatactctgacccccacgctcgac
aagaaccgtgagaagagaggcctggccctggatggaaagctcaaacatgaggacaccaac
ctggcctccagcaccattgttaaggatgtgactaacaaagaggtccttggcatcctggtg
tcctacagggtcaaagtcaaactggtgatctctcgcggaggagatgtgtcggtagagctg
ccctttgtcttaatgcaccccaaacccacagagccgcccacatcccgcccgcagtcaact
gtgccagagtctgaccctcccatcgacaccaacctgatagaatttgaaacaaatagtttc
tcccaagatgacgactttgtgtttgaggactttgcccgcctacggcttaaaggaatggct
gatgataaggacgaggactgctag

KEGG   Esox lucius (northern pike): 105027032
Entry
105027032         CDS       T04894                                 

Definition
(RefSeq) beta-arrestin-1
  KO
K04439  beta-arrestin
Organism
els  Esox lucius (northern pike)
Pathway
els04010  MAPK signaling pathway
els04144  Endocytosis
els04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105027032
   04340 Hedgehog signaling pathway
    105027032
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    105027032
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:els04131]
    105027032
Membrane trafficking [BR:els04131]
 Endocytosis
  Clathrin-mediated endocytosis
   GPCR adaptor proteins
    105027032
SSDB
Motif
Pfam: Arrestin_N Arrestin_C
Other DBs
NCBI-GeneID: 105027032
NCBI-ProteinID: XP_012991080
UniProt: A0A3P9AHD8
LinkDB
AA seq 417 aa
MGDKGTRVFKKASPNGKLTVYLGKRDFVDHVDLVEPVDGVVLIDPEYLKERKVFVTLTCA
FRYGREDLDVLGLTFRKDLFVANIQAFPPVPEDKKSLTRLQERLIKKLGEHAHPFTFEIP
LNLPCSVTLQPGPEDTGKACGVDFEVKAFCAENVEEKIHKRNSVRLVIRKVQYAPEKPGP
QPMAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKMKISVRQYAD
ICLFNTAQYKCPVAIEETDDIVAPSSTFCKVYTLTPFLNNNREKRGLALDGKLKHEDTNL
ASSTLLRDGANKEILGIIVSYKVKVKLVVSRGGLLGDLATSDVHVELPFTLMHPKPIEDA
IYRDAPDETPLDTNLIEFDTNDDDIIFEDFARQRLIGAKDDKDEDDEGTDSPQMNDR
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgggagataaaggcacacgggttttcaagaaagcaagtcccaatggaaagctgaccgtg
tacctggggaagagggactttgtggaccacgtcgacctggtcgagcctgtagatggtgtg
gtgttgatagacccagagtacctgaaggaaagaaaagtatttgtaacattaacatgcgcg
tttcgttatggtcgtgaggacctggatgttctgggcttgacctttcggaaggacctcttc
gtggccaacatccaggccttccccccagtgccggaagacaaaaagagcttgactcgcctt
caagaacgcctgatcaaaaagctaggggagcacgctcatcctttcacctttgagattcca
ttgaacttaccatgctcagtcaccctccagcctgggcctgaagacacagggaaggcctgt
ggagttgactttgaagttaaagctttctgcgccgagaatgtagaagagaaaatacacaaa
aggaactccgtgcgtctggtgatccgaaaagtccagtatgccccagagaagcctggccct
cagccaatggcagagaccaccagacagttcctgatgtctgacaaaccactgcatcttgag
gcttcactagacaaagagatctactaccatggagagccgatcagcgtcaacgttcacgtc
acaaacaacaccaataagactgtgaagaaaatgaagatttcagtgcgtcagtacgcggac
atctgcttattcaacacggcacagtacaaatgcccggtcgcaatagaggaaacagatgac
atagtagctccaagttcaacgttttgtaaagtctacactttaacgcctttcctcaataac
aatcgagagaaacggggcctagctttggacgggaaattgaaacatgaggacacaaacctg
gcttctagtacactgttacgagacggcgccaacaaagagatcctgggtattattgtatcc
tataaagtcaaagtgaagcttgttgtatctcgaggcggactcttaggagatctggcaaca
agcgacgttcacgtcgagctccccttcacgttaatgcaccctaaaccaattgaagacgca
atctacagagatgctcctgatgagacaccactggacacaaacttgatagaattcgacaca
aacgacgatgacatcatctttgaggactttgcaaggcagcggctgatcggagcaaaagat
gacaaagatgaggacgatgaggggaccgactctccccagatgaacgacagataa

KEGG   Esox lucius (northern pike): 105027656
Entry
105027656         CDS       T04894                                 

Gene name
arrb2
Definition
(RefSeq) beta-arrestin-2 isoform X1
  KO
K04439  beta-arrestin
Organism
els  Esox lucius (northern pike)
Pathway
els04010  MAPK signaling pathway
els04144  Endocytosis
els04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105027656 (arrb2)
   04340 Hedgehog signaling pathway
    105027656 (arrb2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    105027656 (arrb2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:els04131]
    105027656 (arrb2)
Membrane trafficking [BR:els04131]
 Endocytosis
  Clathrin-mediated endocytosis
   GPCR adaptor proteins
    105027656 (arrb2)
SSDB
Motif
Pfam: Arrestin_N Arrestin_C
Other DBs
NCBI-GeneID: 105027656
NCBI-ProteinID: XP_028973483
LinkDB
AA seq 411 aa
MGDKAGTRVFKKSSPNCKLTVYLGKRDFVDHLDHVDPVDGVLLIDPEYLKDRKVFVTLTC
AFRYGREDLDVLGLSFRKDLYISTFQAFPALPAEESKPLSRLQERLLKKLGQHAHPFNFT
IPQNLPCSVTLQPGPEDTGKACGVDFEVRAFCAKTVEEKIHKRNSVRLVIRKVQYAPEKP
GPQPMVETTRSFLMSDRSLHLEASLDKELYYHGEPISVNVHVTNNSTKTVKRIKTSVRQY
ADICLFSTAQYKCPVAQEEADDQVSPSSTFCKVYTLTPTLTNNREKRGLALDGKLKHEDT
NLASSTIVKDVSNKEVLGILVSYRVKVKLVVSRGGDVAVELPFVLMHPKPSDQPTSRPQS
VVPETDAPVDTNLIEFETNNFSQDDDFVFEDFARLRLKGMKDDKDEDDHFC
NT seq 1236 nt   +upstreamnt  +downstreamnt
atgggagataaagcggggaccagagtctttaagaagtccagccccaactgcaagctcaca
gtttatctaggaaagagagattttgtagatcacctagaccatgtagatccagtggatgga
gttctgctgatagatccagagtacctcaaagaccggaaagtctttgtgaccctgacttgt
gcgttccggtacggtcgagaggacctggacgttctaggcctgtccttcaggaaggatctg
tacatttccaccttccaggccttcccggccctccccgcagaggagagcaaaccacttagc
cgtctgcaggaacgcctgctgaagaagctgggccaacacgcgcatccgttcaacttcact
atcccccagaacctgccctgctccgtcaccctacagccaggtccagaggacacggggaag
gcttgcggagtagattttgaggtcagggccttctgcgccaagactgtggaggagaagatc
cacaaaaggaactcggtgcgcctggtgatccggaaggtgcagtatgccccagagaagccc
gggcctcagcctatggtggagaccacgcgatccttcctcatgtcagataggtccttacac
ctagaagcttcgctggataaagagctctactatcatggggagcctataagtgtgaacgtc
catgtcaccaacaactccaccaaaacagtcaagaggatcaaaacctcagtgcgtcagtac
gctgacatctgcctgttcagtacggctcagtacaagtgtcctgttgcacaggaggaggca
gatgaccaggtatcccccagtagtaccttctgcaaggtgtacactttgacccccacgctc
accaacaaccgcgagaagagaggtctggctctggatggcaagttgaagcacgaagacacc
aacctggcttccagcaccatcgtgaaagacgtgtccaataaggaggtgctgggcatcctg
gtgtcatacagagtcaaagtcaaactggtggtgtcccgtggaggggacgtggcggtggag
ttgccttttgtcctaatgcatcccaaaccctcagaccaacccacctccagacctcagtca
gttgtccctgaaacagatgccccagtggacactaacctgatagagtttgagacaaataac
ttctctcaggatgatgactttgtgttcgaggactttgcccgtctgcggctgaagggaatg
aaggacgataaggatgaggacgaccacttttgctag

DBGET integrated database retrieval system