KEGG   Esox lucius (northern pike): 105024250Help
Entry
105024250         CDS       T04894                                 

Definition
(RefSeq) zinc finger CCHC domain-containing protein 2-like isoform X1
  KO
K22700  Zinc finger CCHC domain-containing protein 2
Organism
els  Esox lucius (northern pike)
Brite
KEGG Orthology (KO) [BR:els00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    105024250
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-CCHC Vault
Motif
Other DBs
NCBI-GeneID: 105024250
NCBI-ProteinID: XP_010892384
UniProt: A0A3P8YFU2
LinkDB All DBs
AA seq 1017 aa AA seqDB search
MLKMKLPMQTAEEGVHTVEDTQENTDSSGHTSVPYSGVNHRFKYSTSESCNLSQIGKEVV
FEWFGRHLSPSKRIEFMYGLLHMCHPLELRFLGSCLEDLARKDVHVLDSEIRANSQSDLG
LLMDVADPVVRSKLLVCLSLLGSENRECAGTLYRALSHMDPTLYLNSCYDVPLSPRGTTQ
NVPDQNSTPEWGVEAQRFGHPSGSTLELESGSLEHLALLLTMASLHPAFSFHQRSTVRHH
LDNVERAIEGKMHCHNRTSVQHYGLWREEPSPNKTDLGASAHCVSNHLPNRTSFQREAFH
IDKIVLKRISWNQGNREYCIEVQWSDSTWSTVTKTHHELDDFLSKLLCKRSSDPFERGLL
KLLAQGAQYEPRELERALQERLLSAPEAFRQRGEVCRFLLPNCGVCKGLCPGLSLQGDNP
VPSAKTRRATMEHFKDDCTEPSSQEEDLAGQFPGHQTSSSSQGQRTLIPKSSQRDIQRPA
VTPEHNGVKERRNKVGTVSCRPGRHQNEEEKRAFAPEQKSRRRPDERWRSEGAKVYIPNG
IVRPQSTHIRQGGSQKSVQDRSGDTWSEASRTRSSPQHEPRERLDGEDLEDLEEERDTNG
SFTGQSIHGKRPRGHRRVKAVATVHPMVPVVYQEESSSTWPGPQHLASVVQNGLVPDRLQ
PADASLADRVLTGTARMVPRESIPSQTSLGDPVGERRVSPPTDPGSSGHLVPQRFRTTTS
LESRSSNPQHPMGAITVIPSTSHMPPLQPARTGPDPASATPPLSAYTPDPGPRPPTLASL
PASATPSSAATVTAPADSPVAGPAQTFPHSTVQGDAPGAEVGQARPQPKPQSHPQQQMGC
DTCGCRDGCGGSHSASPGFYFPPQVGHQVFSNAHLPLFHVPSMSGAGYPGRVQHQGNGAG
QLPFYPPRTASATPLQYVSGPLLRAAHPDRVLVSQAGYNLPQMAPFNRFYAPVYTSMGVG
LGAGVKKSSANVSCYNCGLGGHYALDCKQTSVEAGHQGGFQLKYTAPHSSEGLDKSE
NT seq 3054 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaaatgaagctgcccatgcaaaccgcggaggaaggagtccacacggtcgaagac
acgcaggaaaataccgattccagcggtcatacttcggttccctactctggtgtgaaccat
cggtttaagtattcgacatcggagtcgtgtaacctgtctcaaattggaaaggaggtggtg
tttgaatggtttggcaggcaccttagtccttcaaagcgaatagagttcatgtacggacta
cttcatatgtgtcacccacttgagcttcgctttctgggatcctgtcttgaggaccttgca
cggaaagatgtccacgtcttggactctgagataagggctaacagtcaaagcgacttgggc
ctccttatggatgttgccgaccctgtcgtgcgttccaaactacttgtctgcctgtcactt
ttgggatctgaaaacagagaatgtgcgggaacactataccgtgccttgagccatatggac
cccactctatacttgaacagttgttatgatgttcctttatctccacgtgggaccacacaa
aatgtaccagatcaaaattccactcctgagtggggagttgaggctcagagattcgggcat
cccagcgggtctacactggagctggagtcgggttccctggagcacttggcactgcttttg
accatggcatcgttacacccggcgttctcatttcaccagaggagtactgtcagacatcat
ttggacaatgtggaacgggccatagaggggaaaatgcattgccacaaccgcactagcgtc
cagcattacggcctgtggagggaggagcccagtcccaacaaaactgacctgggtgcgtcg
gcccactgcgtttccaatcaccttcccaaccggacatcattccagagagaagcatttcat
attgacaagattgtactaaagaggatatcttggaaccagggaaacagggaatattgtatt
gaggtccagtggtctgactcaacttggagcacagtgacaaagactcaccacgagctggat
gacttcctgtccaagcttctgtgtaagaggtcctctgatccctttgagagggggctgctg
aagttgctggcccagggagcccagtacgagcccagggaactcgagagggcattacaggag
aggctgctgtcagctccggaagccttcaggcagagaggagaagtctgcaggtttctcctt
cccaactgcggtgtctgtaagggtttgtgcccaggactaagcctccagggagacaaccca
gtaccttcagcgaagacccgcagggcaacgatggagcactttaaagacgactgcacagag
ccatccagtcaggaggaagacttagcgggtcagttcccagggcatcagacgagcagcagc
agccagggccagaggacactgattccaaagagcagccagagggacatccagagacctgct
gttaccccagagcacaatggcgttaaggagaggaggaacaaagtgggcaccgtgtcctgt
aggccaggccgacatcagaacgaagaggagaaaagggctttcgctccagagcagaagagt
cggagaagacctgatgagaggtggagaagtgaaggggccaaagtttacataccgaacggt
atcgtcagaccacagtccacacacatcagacagggtggcagtcagaagtcagtccaggac
agatctggagacacttggtctgaggcctccaggactcgctccagcccacagcacgagccc
agggagagactggacggggaggaccttgaagacctggaggaagagagagacaccaatggg
agtttcacaggccagtctatccacgggaagagaccaaggggtcacagaagggtcaaggct
gtggctacggtccatccaatggtgcctgtagtgtaccaggaagagtcgtcctccacttgg
cctggtccccaacatctagcctccgtggtccagaacggcctggtcccggaccgcctacag
ccagcggacgcttcattagcagaccgggttctgaccgggactgcccgcatggttcctcgg
gagtccatcccaagtcagacgtccctgggcgaccccgtgggagagaggcgtgtgtcccct
ccgaccgacccgggctccagcggtcacctcgtaccacagcgcttcaggaccacgactagc
ctggagagtaggagctctaacccccagcaccccatgggcgcaatcaccgtcatcccctcc
acctcccacatgcctcccctgcagccagcgcgcaccggccctgacccagcctccgccacc
ccgcccctgtcggcctatacccccgaccctggcccaaggccccccaccctggccagcctc
cctgcctccgcgacgccatcttcagcggccactgtcaccgcacctgccgacagcccagtc
gccggcccggcccagacgttcccccacagcacggtccagggagacgcccccggggcagag
gtgggacaggcgcgtcctcagccgaagccgcagtcccaccctcagcagcagatgggctgc
gacacctgtggctgccgtgacggctgtggcggtagccactccgcctcccccggcttctac
ttccctccccaggtggggcaccaggtgttcagcaacgcccacctcccgctcttccacgtg
ccctccatgagcggcgccggataccccggacgtgttcagcaccagggcaacggcgccggc
cagctgcccttctacccccctcgcacggcctcggccacgccgctgcagtatgtcagcggg
cctctgctccgcgccgcccacccggaccgcgtgctggtctcccaggcggggtacaacctg
ccgcagatggcacccttcaaccgcttctacgcacccgtgtacacgtcgatgggagtggga
ctgggcgcgggcgtgaagaagagcagtgccaacgtctcctgctataactgtgggctcggc
gggcactacgccctggactgcaaacagacctctgtggaagctgggcatcaaggtggcttt
cagctgaagtacacagccccccactcctctgaaggtcttgacaaatctgagtga

DBGET integrated database retrieval system