KEGG   Esox lucius (northern pike): 105024272
Entry
105024272         CDS       T04894                                 

Gene name
megf8
Definition
(RefSeq) multiple epidermal growth factor-like domains protein 8
  KO
K23664  multipile epidermal growth factor-like domains protein 8
Organism
els  Esox lucius (northern pike)
Pathway
els04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    105024272 (megf8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:els04990]
    105024272 (megf8)
Domain-containing proteins not elsewhere classified [BR:els04990]
 Laminin domain-containing proteins
  Laminin EGF-like domain-containing proteins
   105024272 (megf8)
SSDB
Motif
Pfam: Kelch_3 Kelch_4 Kelch_5 Kelch_6 Kelch_1 CUB Kelch_2 PSI Laminin_EGF EGF_CA EGF
Other DBs
NCBI-GeneID: 105024272
NCBI-ProteinID: XP_010892421
LinkDB
AA seq 2887 aa
MRTKTRELVVRMISSLLPIPLLGVLLAVAPGCLAGDCKGHRQVLRGPPGYVTDGPGNYSV
NGNCEWLIKAPSSNYRIVLNFTFMETECTYDYLFVYDGDSYQSPLLASLSGTTLPQPIEA
KSGKMLLHLFSDANYNLLGFNATYSISVCPGACGGHGRCDTASSLCQCHLGWGGVDCTTP
LCPQTCNLHGTCDKRGERCLCNADFLGQSCQLGLRDDSGAGQWWQVNRGDSNTRPRTGSA
GVYLSSTGAMYLFGGFDLNRALGDLVKYNFSSNQWENRSYGHSPVARHSHTAVEWKGNMV
IFGGQLASGSLASDVWMYRPIQDDWQQLGQSHLPGAPRLANHAAAVVDNFLYIFGGRTEE
DMFSSSLYRFSLWGSAVWEAVQPTGGKPPATAGHSMVFHPPSRTLLVYGGHRPTTARFSV
RVNSTDVFHVDRRFWTSFRSRFPATGPRERAFHSATVIGNYMVVYGGNVHIHYQEEKCYD
EDIFFYHLGCHQWVSAGESLQHRGEAVRGRYSHVAAVMEGRVLLVAGGYSGVARGDLVAY
KVPLFVSSDPGDRDALCAEAPDESACLKNPECSWCEGRCREYQPTNPCGSTGCLGLARFL
SDCQSCLVFSGAPGSLPRAQGDFGWCVQNESCLPVSDQTACRVDQISGAYGWWGERTRFL
VSLLNCRTENYVPGLHLLTFQHPRNDSQPDKVSILRSTSIILSPTTEMDVTLQFRGFIHP
LWGAPPPAPPPTETVSMWARIQRLHFEARMAAGPNSLQLKEVVGRWAAHQEKETKLLSRP
EGGRLFPNLTRGNRYLVQAEGYLNNSGSGQTSEMALTWNRTALPGGSEISFLFLEPYRSG
SCSGYQSCLACLSDQSCGWCPSLGRCLFRALPDLEPCPDEHGVGERHLLLAPQHCTLCEE
YRDCSTCAQDPYCEWQINSSKKGDYQCSRRGRLDGSIRHPGGCPKVCNQRRTCGECLSNS
SQCAWCESAQACFYFAAYLTKYPYGECRDWYDSVHSVPQCKQCSALASCTDCLQTFQCGW
CGDYNNPTIGKCLRGDWAGMDDPSVNNCSVAVAEVRATSPEPQTSAPPRPMEMELELEHL
DEGERDAVWSYPTCPDVEECRLGLHTCHPFATCVNTPTSYECHCERGYTGDGTLHCNQTC
YNECREGQCSGSPRFECECSLGWTSDPATLVLSGVECDVDCGCNFHSSCITAPGICDHCQ
DWTIGPQCEHCRPGSFGSALAGGGGCVPCQCNGHGDPLQGYCHNQTGQCYCTHHTQGPHC
ESCLPGYYGDPRNNGTCFRQCQGRSVILSHQSPLSELPVSSSLGWKGGVSGKGGLPYCLW
VLSVSEDLAPCVPGKLCPPVAFSLHPDSHTQCTSSYVYVFDGLPRFLSNGVVHLDHNLIG
AFCGTTRSQPITVEATSGVISVYFEANVSYERPQGFNASFWVRRCSQGSEAGEDGSPVCQ
AGAQCSKGLCQCPQGYGGPYCDRHVCPEDCGLAEGRGSCNISLGVCVCADGWGGSDCSTP
LDSGSIVWETLLDTQLTASQAHRFLHRMGHSLVSGPQGTLWMYGGLSLSDGILKDVYRYS
VSERRWTQMLTSPGEEGSTPSPRYYHSSALLASHDPLSGVQGTTHNLMLVVGGVTQTGVA
MDTWSLNLSSLVWKEYKSSVLPPLAGHTLTVRRETSVLLIGGYSPENGFNHHLLEFSVHS
GNWTVAPHTGTPPTGLYGHSAVYHEQTDAVYVFGGYRFHVETVEPSGELYSLYYPNLTWS
LLVPSQGTKPLSRFFHAAALMKDTMVIVGGRTGEEDYSNTVSLYQINCNTWIQPEPAVGE
PINRSVSLAMTGLGGRLFLTGGFNGVTLGRLVTLTLPSDPCALHSTPEACNTTMGSCVWC
RATCTSSDTAERLGCAISQSPCSPTPRLPDQCRRLKTCSECLARHPRTFSGPTQSALQCK
WCTNCPEGACISTTVSCTTEHDCRINQREIFLSSNCTETSCEASDCPKCTASGKCMWTRQ
FKRTGETRRILSVNPTYDWTCFSYALLNVSPMQVESSPPLPCPPPCHSLGTCSLCLGSRG
SDGGWQRCVWSMVLQQCMSPSFLPLRCEAGQCGRLLSGWDSCSPQCSQLSQCSQCIARPQ
CGWCAVRGGNGAGRCQQGGLDGVSEGVCPRGNSSWSFLHCPEEDECANGHHHCNSTQDCH
DLTQGYHCICKQGYVLSSVSGQCEPVCAQGCVNGTCVSPGVCQCHFGFVGENCSSQCRCN
KHSNCKGVTEPDKCLECKNNTMGDHCEKCKPLFVGSALGGGTCRPCREFCRGNSAVCLSR
NEHKRALDHPHDHPLDPDSIVRWVSEGPPEDSAVCVNCQNNSVGDKCESCLSGYFLLQGK
CDKCQCNGHADTCNEHDGTGCPCQNNTETSSCLSSPQNDRKDCYRTQCAKCKDSFNGTPV
NGRQCYRQFNVDNECCFDPTSQTNCFHDPTIRNLPKGRTVFFAAQPKFTNVDIRVTIDVT
FGEVEVYVSNSHDTFIVEVDRHTGVHSIKIEDESAARGGSSGGDKEPPLSPMKVYANSSS
SPGGPMLPNTPQQLQAKQAMDREVREETAEGLISYITVWKPQTVLVVRGVRDRVVITFPH
EVHSLKSSRFYIALRGVGTEDRQGESQGLLFLRQDQAHIDLFVFFSVFFSCFFLFLSVCV
LLWKIKQFMDFRREQRRHIQEMTKMASRPFAKLTVYLEPEEPQLIYLPAPGGVGVGGSAV
ALARTGKLSAVVVGQRGRAGAMSYKHDPGSGPNADPHHHHHLTLGGGGNSGQHLPLHYLN
THHYAPTTTTTPASHHHHHPSSHSGYQHFCRSDPFLSQLMGFSYSTFKVGPITLEPTDDG
MAGVATVLIQLPGGILAPNRACLGSALVTLRQNLQEYCGHGNGGGHPGAGGGRKGLLGHQ
HLTTMAM
NT seq 8664 nt   +upstreamnt  +downstreamnt
atgaggacaaagacacgggaacttgtggtgaggatgatttcttctctcctccctatcccc
ctgctcggggtcttgctggctgtggccccaggatgtttggctggggactgtaagggccac
agacaggtacttagaggcccccctgggtatgtcacagatggccctgggaactactctgtt
aatgggaactgtgagtggcttatcaaagcccccagcagcaattaccgtatagtcctgaac
ttcacctttatggagacagaatgcacctacgattacctgtttgtctatgatggagactca
tatcagagccccctactggccagtttgagtggcaccacccttccgcagcccatagaagcg
aagtctggcaagatgctgcttcacctcttcagtgatgccaactacaacctcctaggcttc
aatgccacctactcaatatctgtgtgccctggggcctgtggtggccatgggcggtgtgac
actgcctcctccctgtgccagtgccacttgggctggggaggagtggattgcaccaccccc
ctgtgtccccagacatgcaacctgcacggcacttgtgacaagagaggagagcgttgtctc
tgcaacgctgacttccttggccagagctgtcagctaggtcttcgtgatgacagtggggcg
gggcagtggtggcaggtgaacaggggtgactccaacacacgaccccgcaccggctctgct
ggggtctacctgtcctctactggagctatgtacctgtttggagggtttgacttgaaccgt
gctctgggggacttggttaaatacaacttcagctcaaaccagtgggagaacagatcctat
ggacactccccagtggctcgtcactcccacacagcagttgagtggaagggtaacatggtt
atatttggagggcagcttgccagtggttctttagccagcgacgtctggatgtatcgacca
attcaggatgactggcagcagcttggccaatcacacctcccgggtgcacctagactggcc
aaccatgcggcagctgtggtggacaattttctctacatctttggaggtcgtactgaagag
gacatgttctcctcatcgttgtaccggtttagtctgtggggatctgcggtgtgggaggca
gtgcagcccacaggggggaagccccccgctacagcaggccactccatggtgttccacccc
ccctccaggaccttgctggtctacgggggccacaggcccaccaccgccaggttcagtgtg
cgcgtgaactctacagatgtattccatgtagaccggaggttctggacctccttccgctcc
cgttttccagccaccggccccagggagagagccttccactcagccacagttattggcaac
tacatggtggtctatggggggaatgtgcacatacactatcaggaggagaagtgttatgat
gaggatatcttcttctatcacctgggttgtcaccagtgggtgtctgctggggagagcctt
caacaccgaggggaggccgtgagagggcgatattcccatgtggctgctgtaatggagggc
agggtgttgctggttgctgggggttacagtggtgttgcccgtggagatctggtggcatat
aaagttccgctgtttgtcagcagcgacccaggagaccgggacgctttgtgtgctgaggcc
cctgatgaaagcgcctgtctgaaaaacccagaatgcagctggtgtgagggccgctgtcgg
gagtatcaacccaccaacccgtgtggcagcactgggtgcctgggtctggcccgtttcctg
tccgactgccagtcctgcctggtgtttagtggggctccaggctccctgcctcgagcccaa
ggggactttggctggtgtgtccagaacgagtcctgcctacctgtgtcagaccaaaccgcg
tgccgcgtggaccagatctcaggggcgtacggctggtggggggagcgtacgcgtttcctc
gtctccctccttaactgtcgcacagagaactatgtaccgggactacacctgctgaccttc
cagcacccccgcaatgactcccagcctgacaaggtgtctatcctgcgcagcacctccatc
atccttagccccaccacagagatggatgtcaccctgcaattccggggcttcatccacccc
ctgtggggtgccccaccacctgctccccctccaaccgagaccgtttcgatgtgggcccgc
atacaaaggctccactttgaggcccgcatggctgctggacccaactccctgcaactgaag
gaggtagtgggccgctgggctgcacatcaggaaaaggagacaaagctgctctcccgtcct
gagggtgggcgtctgttccccaacctgacccgtgggaaccgctacctggtccaggccgag
ggctacctcaacaactcaggctctggacagactagtgagatggcgttgacgtggaacaga
actgcgttgccagggggaagtgagatttcgttcttgttcttggagccctaccgttctggt
tcctgctcgggttaccagtcctgtctggcctgtctgtctgaccagtcctgtggctggtgc
ccttctctgggccgttgtcttttccgtgcccttcccgacctagagccctgcccggatgaa
catggagtaggggagcgccaccttctgttggccccacaacactgcaccctctgtgaggag
tacagggactgctccacctgtgctcaggacccctactgcgaatggcagatcaactccagc
aagaagggggactaccagtgcagccggcggggtagactggatggatccattcgccaccca
ggaggctgtcctaaagtctgcaaccagaggaggacgtgtggggagtgtctgtctaactcc
agccagtgtgcgtggtgtgagtcagcccaggcctgcttctactttgctgcctacctcacc
aagtacccctatggagagtgcagggactggtatgacagtgtccactctgtaccccagtgt
aagcagtgctctgctctggccagctgcaccgactgcctccagacattccagtgcggctgg
tgtggcgactacaacaaccccaccatcggcaagtgtctcagaggagactgggctgggatg
gatgatccctctgtgaataactgcagtgtggctgtggctgaagtgcgggccactagccct
gagccccaaacctctgcccccccacggcccatggagatggagctggagctggagcaccta
gatgagggggagagggatgcggtctggtcctaccccacctgtcctgatgtggaggagtgt
aggttgggcctccacacctgccaccctttcgccacttgtgtgaacacccccacctcctac
gagtgccactgcgagaggggctacactggagacggcacgctgcactgcaaccagacttgt
tacaatgagtgtcgcgaggggcagtgcagcggtagcccgcggttcgagtgtgagtgttcc
cttggctggacatctgacccagccaccctggtcctgagtggagtggagtgtgatgtcgac
tgtggctgtaacttccatagcagctgtatcaccgctcccggcatctgtgaccactgccag
gattggacgattggcccacagtgtgagcactgtcggccagggagttttggctctgcgctg
gctggtggtgggggctgtgtgccctgccagtgtaatggccacggagacccactccagggc
tactgccacaaccagacaggccagtgctactgtacacaccacacccagggtccacactgt
gagtcctgcctgcctggatactacggagatcccagaaataatggcacctgtttccgtcag
tgtcaggggcgctctgtgatcctgtcccaccagtcacccctctctgagctgcccgtctcg
tcctccctgggctggaaagggggtgtgagtggtaaggggggtctcccttactgtctgtgg
gtgctgtctgtgtctgaagacctggcgccctgtgtaccgggcaagctgtgccctcccgtg
gctttcagtcttcaccccgactcccacacacagtgtacaagctcctacgtatacgttttt
gacggcctgccccgtttcctgagcaacggtgttgtgcacctggaccacaacctgataggt
gcattctgtggaacaacccggagtcagccaatcactgttgaggccacgtcaggtgtgatc
tcggtctactttgaagccaacgtctcgtacgaacggcctcaaggtttcaacgcttccttc
tgggtgcgccgctgtagccagggctctgaggcaggcgaggatgggtcgcctgtgtgccaa
gcaggggcgcagtgctccaaggggctgtgccagtgtcctcaggggtacgggggaccctac
tgcgacaggcacgtctgtcccgaggactgtggactagcagagggcaggggctcctgcaac
atttctttgggagtgtgtgtgtgcgcagatggttggggtggctctgactgctccactccc
ctcgactctggcagcatagtgtgggaaaccctactggacacacagctcacagcaagccag
gcccataggttccttcaccggatgggccactctcttgtgtccgggccccaggggactctc
tggatgtatggaggactgtctctttcagacgggatcctcaaagacgtctacaggtactct
gtgtcagaacgacgctggactcagatgctgaccagcccaggggaggagggctccaccccc
agtccccgctactaccactcctctgccctgctggccagtcacgatcctctctctggtgtc
cagggaaccactcacaaccttatgttggtggtaggcggggtcacgcagactggtgttgcc
atggatacatggagccttaaccttagtagtctggtgtggaaagagtacaagagctcagtg
ctgcccccgctagcaggtcacactctgacagtacgtcgggagacctctgtgctgctcatt
ggagggtattctccagagaacggctttaaccaccacctgttggaattcagcgttcactct
ggcaactggaccgtcgccccccacaccggcactcctcctacaggtctgtatggccactcc
gctgtgtaccacgagcagacagacgctgtgtacgtgttcggaggctatcgctttcatgtg
gagacagtggagccctcaggggagctctacagcctctactaccccaacctgacctggtct
ctgctggtcccctcacagggcacaaagcccctttctcgtttcttccacgctgcagccttg
atgaaggacaccatggtgattgtgggagggaggacgggagaggaggactacagtaacaca
gtgtctctctaccagatcaactgtaacacctggatacagcctgaaccagcagtaggtgag
cctataaaccgttcagtgtcactggccatgacaggcttgggcggacgactgttcctcact
gggggattcaacggggtcaccctgggtcgtcttgtcaccctgacgctgccctctgacccc
tgtgccctgcattccacgcctgaggcctgcaacaccaccatgggcagctgtgtctggtgc
agagccacctgtacctcctctgataccgcggagagactgggctgtgccatcagtcagtcc
ccctgctcccccacccctcgtctaccagaccagtgtcgcaggctgaaaacctgcagtgag
tgtctggcacgccaccccagaaccttctctggccccacacagtcggctctgcagtgtaag
tggtgcaccaactgtccagagggggcctgcatcagtaccacggtcagctgcaccacagaa
catgactgcaggatcaaccagagagagatatttctgtccagcaactgtaccgagaccagc
tgtgaggcctcagactgccccaagtgcactgcctcaggaaagtgcatgtggacacgccag
ttcaaacggacaggagagaccaggcgcatcctgagcgtgaaccccacctacgactggacc
tgcttcagctacgctctcctcaacgtgtctcccatgcaggtggagtcgtcccccccgctg
ccctgccctcccccgtgccacagcctcgggacatgcagcctctgtctggggtcgcggggc
tcggatgggggctggcaacgctgtgtgtggagcatggtgctccagcagtgcatgagtccg
tccttcctgcccctgcgttgtgaagcgggacagtgtggtcgtctgttgtctggatgggac
tcctgctccccccaatgctcccagctctcccagtgctctcagtgcatcgcccggccccag
tgtggctggtgtgctgtccgcgggggcaacggtgccgggcgctgccagcagggaggcctt
gacggtgtgagtgagggagtgtgcccccgggggaacagcagctggtcgttcctccactgc
ccagaggaggatgagtgtgccaatggccaccatcactgtaacagcacccaggactgccac
gacctgacccaaggataccactgcatttgcaagcagggctatgttctcagcagtgtgtca
ggccagtgtgagccggtgtgtgcccagggctgtgtgaacggaacgtgtgtctcacctgga
gtgtgtcagtgtcactttggctttgtgggggagaactgctcgtctcagtgtcgctgtaac
aaacacagcaactgtaaaggtgtgactgaacctgacaagtgtctggaatgtaaaaacaac
actatgggggatcactgtgagaaatgtaagcccctgtttgtggggtctgctttgggaggg
gggacgtgccgcccctgtcgagagttctgcagggggaacagtgccgtgtgtctctcccgg
aacgaacacaagagggcgttagaccacccccatgaccaccctctggatccagacagcatt
gtgcggtgggtgtcagagggtcctccagaggactcggcagtatgtgtgaactgccagaac
aacagcgtgggggacaagtgtgagagctgccttagcggctacttcctgctgcaggggaag
tgtgacaagtgccagtgtaatggccatgcagacacgtgcaatgaacatgacggcacaggc
tgcccctgtcaaaacaacacagagacatcatcctgccttagcagcccgcaaaacgacagg
aaggattgttaccgaacacagtgcgccaaatgtaaagactccttcaacggcacgccggtc
aatggacggcagtgttaccgacagttcaatgtggacaacgagtgctgcttcgaccccact
tcccaaaccaactgcttccacgaccccaccatccgcaacctgcccaagggacgcacggtc
ttctttgccgcccagcctaagttcaccaacgtggacatccgggtcactattgacgtgacc
tttggagaggtggaagtgtacgtttccaactctcacgacaccttcatcgtggaggtcgac
cgccacacgggcgtccacagcatcaagattgaggatgagtcggcagcccgaggcgggtcg
agtggtggggataaggagccacctctgtcaccaatgaaggtgtatgccaactcgtcgtca
tccccgggagggcccatgctccccaacaccccccagcagctccaagctaaacaggcgatg
gacagagaggtgcgggaggagactgcggaggggctcatttcctacatcacagtgtggaag
ccccagacggtgctggttgtccggggggtccgggaccgcgttgtgatcacctttccacac
gaggtccactccctgaagtccagccgcttttacatcgccctacggggggttggcaccgag
gaccggcagggggagtcccagggcctgctcttcctccgccaggaccaagcccacatcgac
ctctttgtcttcttctctgtgtttttctcttgctttttcctcttcctctccgtctgtgtc
cttctctggaagattaagcagttcatggacttccgcagagagcagcggcgccacatccag
gagatgaccaagatggcgtccaggcccttcgccaagctcactgtctatttggagcctgag
gagcctcagctgatctacttgcccgctccagggggcgtcggggtggggggcagcgccgta
gccctggcccgcactggcaagctcagcgctgtggtagtgggccagagggggcgagcagga
gcgatgtcctacaaacacgacccgggctccgggcccaacgccgacccccaccaccaccac
cacctcaccctgggcggaggaggaaacagcgggcagcacttgcccctgcattacctcaac
acccaccactatgctcccaccaccaccaccaccccggcctcgcaccaccaccaccaccca
tcatcccacagcggctaccagcacttctgtcgctccgaccccttcctgtcccagctcatg
ggcttttcctactccacctttaaggtggggcccatcacactggagcccacagacgatgga
atggcgggcgtggccaccgtcctcattcagctgccggggggcatcttggcccctaaccgc
gcctgtctggggtcggccctggtcaccctgcggcagaacctccaggagtactgtggtcat
gggaacggaggtggacatcccggtgcgggtggtggtcgtaaaggcctgctggggcatcag
cacctcaccactatggccatgtag

DBGET integrated database retrieval system