KEGG   Esox lucius (northern pike): 105024283Help
Entry
105024283         CDS       T04894                                 

Gene name
bcl3
Definition
(RefSeq) B-cell lymphoma 3 protein
Organism
els  Esox lucius (northern pike)
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_4 Ank Ank_3 Ank_5
Motif
Other DBs
NCBI-GeneID: 105024283
NCBI-ProteinID: XP_010892434
UniProt: A0A3P8YXX2
LinkDB All DBs
AA seq 709 aa AA seqDB search
MPRTMTMNSHQTLTTAPLDLCTRTSERGSGADKTPACKGRSRDNVGLKVQNTAALYKHVD
SPNTNPSPKVESLEHPCGTFLMKRPVNTGSPEVLEKKHSPTATFNTRFTPTLSKGEAISG
ENSTPDRATVDRSRLPFRKRPYNTGQETLGLSRRPTQTGGEDRLSPDKNTELHCRKSPPK
VVKTDYSDIRDSSSSVPQRQELSTSNNFDNGQHTIGPVRHIQPHQPYCPYPFYPWPSMSS
LVVSVPVPHLPPPLHHQEHTEHLLADVTVATRQDDDGDTALHIAVVQGQEALVHRMIQLL
EVARKDLDIYNNLRQTPLHLAVITHQPRLVETLLLAGADPGALDRNGQTAVHLCCEHGQQ
ACLSVILSHNFISSCLEVRNYEGLTPLHLAVQGRHKELARMLLDAGADINAMDIKSGRSP
LIHAVENNYIDMVDFLIENDCNVNGQSYSGNTALHSACGRGQVDTVRLLLKNRADSSVKN
YHNDTPAMVAKNKRVTDVLRGRGSRNQQSKPQEQQCLSFSPQRNALHSPSRVSGSSSPNH
SLGHSPAPMAPPLHRSKSHSPRAPPTPSPHSQSAESLSGSQSPMEIQEEQLQVRLGSDSV
TTMDISVSQRRAYPLTYSYISALPHQSPITETQIEPLLSGNPSYHSPGLQRHLHSEHHII
LLHTNLPHQATVYPVSQIALGQSRPSSRCSDQSDVSTMSVSSSGGKGES
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atgccgaggactatgaccatgaacagtcaccagactctaaccacagcgccgctggatctg
tgcacaagaaccagtgagcgtgggagcggcgcggacaagactccggcttgtaaaggtcgt
tctagggacaacgtcgggttgaaagtgcagaatacagctgccctctacaagcatgttgac
tcgccaaacacaaatcccagccccaaggtggagtcactggagcatccttgtggaacattt
ttaatgaaacgtcctgtgaatacggggagcccggaagttctggagaaaaaacactcaccc
actgcaacttttaacacgcgattcaccccgaccttgtctaaaggtgaagcgatctctgga
gagaacagcactccagacagagccacagtggacagatccaggcttccttttagaaaacga
ccatacaataccggacaggagactttgggactgtctcgtaggcctacgcaaaccggagga
gaggatcgcttatcgcccgacaaaaatacggagttgcattgcagaaagagtcccccaaaa
gttgtaaagacagactacagtgatatcagggattcctcatcatcagtcccgcaaagacaa
gaattgtctacctccaacaattttgataatggacaacataccatcggcccggttcgtcat
atacaaccacaccagccttactgtccctaccctttctacccatggcccagcatgtcatca
ctggtcgtgagtgtacctgtcccccacctcccgccccctctacaccaccaggaacacact
gaacacctgctggctgatgttaccgtggcaacgcgccaagacgatgacggtgacacggct
cttcacatagctgtggtgcaagggcaggaagctctggtccacagaatgatccaactcctg
gaagtggcacgcaaagacctagacatctacaataacctgagacagacccctctccatctg
gccgtgattacccatcagccccgacttgtggagacgttgctgcttgcgggagctgacccg
ggggctttggatcgtaatggacagactgcagttcacctgtgttgtgaacacggtcagcaa
gcctgcttatctgtgatcctctcacacaactttatctcatcctgtctggaggtcaggaac
tatgagggcttgacccctcttcacctggctgtccaaggtagacacaaggagctggccaga
atgctgctagatgctggggccgacatcaatgctatggacatcaagagtggtcgcagtcct
ctcatacatgcagtggaaaacaactacattgacatggtggacttccttattgagaatgac
tgtaacgtgaatggccagtcatacagtgggaacaccgccctgcacagtgcctgtgggcga
ggccaggtagacacagtcaggctacttctgaagaacagggctgacagcagcgtgaagaac
taccacaatgacacccccgcaatggtggccaagaacaagagggtaacagatgtgctacga
gggaggggctccagaaaccagcagtccaaacctcaggagcagcagtgcctgtccttctca
ccccaaaggaatgcgctccactcacctagcagagtttccggttcctcctctcccaaccac
agcctcggccactcgccagctccgatggctccgcctctccaccgcagcaaatcccattcc
cccagggcacctcctactccctctccacacagccaatcagctgagagcctttcaggcagc
cagtctccaatggagatccaggaggagcagctgcaggtcaggcttggctctgacagcgtg
acaacaatggacatcagcgtgagccagagaagggcctacccactgacctatagctacatt
tctgcactgccacaccagtccccaatcactgagacccaaatagagcctttactatcaggc
aacccatcctatcactcccctggcctccagagacatcttcattcagagcatcacattatc
ctcctacacaccaatttacctcaccaagccaccgtctatcccgtctcccaaatagccctt
ggccagtcccgcccctccagtcgctgcagtgaccaatcggatgtatccaccatgagtgtc
agcagcagtgggggcaaaggtgaaagttga

DBGET integrated database retrieval system