KEGG   Esox lucius (northern pike): 105024303Help
Entry
105024303         CDS       T04894                                 

Definition
(RefSeq) trypsin-3
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
els  Esox lucius (northern pike)
Pathway
els04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    105024303
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:els01002]
    105024303
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:els04147]
    105024303
Enzymes [BR:els01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     105024303
Peptidases [BR:els01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   105024303
Exosome [BR:els04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   105024303
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2
Motif
Other DBs
NCBI-GeneID: 105024303
NCBI-ProteinID: XP_010892467
LinkDB All DBs
AA seq 247 aa AA seqDB search
MKVFILLALFTVAFAAPFLDEDDKIVGGYVCQKNSVAYQASLQSGYHFCGGSLISSLWVV
SAAHCYKSRIQVRLGEHNIATNEGTEQFINSEKVIPHPKYNSRNLDNDIMLIKLSTPAKL
NSYVRTVALPSSCASSGTRCMVSGWGNLSGSSTNMPDTLRCLDLPILSASSCNSAYPGQI
TSNMFCAGFMEGGKDSCQGDSGGPVVCNGQLQGVVSWGYGCAQRNKPGVYAKVCNYNSWI
SSTMSSN
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcttcattcttcttgctctctttacagtggcatttgccgccccttttcttgat
gaggacgacaagattgtcggagggtatgtgtgccaaaagaattccgtggcctaccaggca
tctctgcagtctgggtatcacttttgtggtggttccctgatctccagcctgtgggtggtg
tctgctgctcactgctacaagtcccgcattcaggtgcgtttgggtgagcacaacattgcc
accaacgagggcacggaacagttcattaactccgagaaggtcatcccacaccccaagtac
aacagccgcaacctggataacgacatcatgctgatcaagctgagcacgcctgcaaaactg
aacagttacgtgcgcaccgtggctctcccctccagctgtgccagctctggaactcgctgt
atggtctctggctggggcaacctttctggcagtagcaccaacatgcccgacaccctgagg
tgcttggatctccccatcctgagcgccagcagctgcaacagcgcctaccctggacagatc
acttccaacatgttctgcgctggcttcatggagggaggcaaggactcttgccagggagac
tccggtggccctgtggtgtgcaacggtcagctccagggtgttgtgtcctggggttacggg
tgtgcccagaggaacaagcctggtgtctatgccaaggtctgcaactacaattcctggatc
agcagcaccatgtcctccaactaa

DBGET integrated database retrieval system