KEGG   Esox lucius (northern pike): 105024522Help
Entry
105024522         CDS       T04894                                 

Gene name
ace
Definition
(RefSeq) angiotensin-converting enzyme isoform X1
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
els  Esox lucius (northern pike)
Brite
KEGG Orthology (KO) [BR:els00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:els01002]
    105024522 (ace)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:els04147]
    105024522 (ace)
   04090 CD Molecules [BR:els04090]
    105024522 (ace)
Enzymes [BR:els01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     105024522 (ace)
Peptidases [BR:els01002]
 Metallo Peptidases
  Family M2
   105024522 (ace)
Exosome [BR:els04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   105024522 (ace)
CD molecules [BR:els04090]
 Proteins
  105024522 (ace)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-GeneID: 105024522
NCBI-ProteinID: XP_010892796
LinkDB All DBs
AA seq 1297 aa AA seqDB search
MARMLLAAMGLILPISVLCEIVLPPEWMPGNYSSTEEGAIKFVDAYNTSAEQVTYLNQEA
SWTYQTNITTHNSDKKVESDGLKQAFTEAWGKKAKVTFNPELLATFNTTLQRRIHKINIL
GPANLPAAERNEYNRILSEMSSIYSTAKVCPKPEECWSLEPELTEIMASSRSYKRLLYAW
EGWHNASGVPLKGLYPKFVKLSNQAYVADGFNDTGAYWRSWYESSSFENDLEVIYKQVQP
LYQNLHAFVRRKLYNHYGPKYINLKGPIPAHLLGNMWAQTWNNIYDMMIPFPGKPNVDVT
KEMEANKWNATHMFRVAEEFFTSLGLIKMPDEFWNKSMLEKPDDREVVCHASAWDFYNRK
DFRIKQCTTVNMQQLFTVHHEMGHIEYYLQYKDQPISFRRGANPGFHEAIGDVMSLSVST
PKHLASIGLLPNATNDPESDINYLLKMALEKIAFLPFGYLIDQWRWNVFSGHTPPERYNA
DWWHLRTKYQGICPPTKRTEEHMDAGAKYHIPGNTPYIRYFVSFILQFQFHKKLCDAAGH
RGPLHTCDIYQSKEAGKILETVLKSGESKPWQNVLQEAIGTDKMSASALMEYFKPIITWL
EEQNKATNETLGWPDFNWVPXVPEGYPEDVDKVTDELKAKAFLEEYNRTAEVVWNAYTEA
SWAYNTNINEENKQTMLKKNLEMSNHTLTYGKNARKYDTTDFQDNSVKRILKKLSDIERA
GLPDNELVEYNNLLANMETKYSVANVCRDNGTCHPLDPDLQKIMAESRDYSELLFAWQGW
RNASGRELRQDYKRYVQLANKAATLNGHSDNGAFWRSLYETPTFEEDLESLWKELEPLYL
NVHAYVRRSLYKKYGGKYINLKGPIPAHLLGNMWAQTWSGIMDLAIPYPNATQVDATPAM
IAKGWNAVRMFNESDHFFTSLGLLPMPPEFWSKSMLEKPTDGRNVVCHASAWDFYNRKDF
RIKQCTVVTMDDLITVHHEMGHVQYFLQYKDQPISFRDGANPGFHEAIGDVLALSVATPR
HLKEIGLLDVVEANKESTINYLMSIALDKIAFLPFGYLMDQWRWKVFDGRISESEYNKEW
WNMRMKYQGLCPPVARTEQDFDPGAKFHIPANVPYVRYFVSFIIQFQFHQALCKAANHKG
PLHECDIYRSKEAGKLLGDVMKLGFSKPWPEAMAMITGEPVMSAKPLVEYFKPLTDWLEA
ENNKNGEVRGWPEYDWKPPSPGSVTLPLTTVPHDTSPTIPPHAVDFLGMKLDHSAASAGQ
WVLLVLGLVLLVATILLGYKYKKSKRRSLSSSEVELK
NT seq 3894 nt NT seq  +upstreamnt  +downstreamnt
atggccagaatgcttttggcagcgatggggctgatactgccaatatcagtactctgtgag
attgtcctgccacctgagtggatgccggggaactattcttccacagaagaaggtgccata
aagtttgttgacgcttacaatacctccgctgagcaagtcacctacctaaaccaagaggca
agctggacttaccagaccaacattacaactcacaactcggataaaaaggtggaatctgac
gggctgaagcaagctttcacagaagcctggggtaagaaggccaaagtgacctttaaccct
gagctgctggcgaccttcaacactaccctacagaggagaatccacaagatcaacattctg
ggtccagctaaccttcctgcagcagaaagaaatgagtacaatcgcatccttagtgaaatg
tcttcaatatactccactgccaaagtgtgtccaaagcctgaggaatgctggtctctcgag
ccagagctgacagagatcatggccagctcacgaagctacaagagattgctttatgcttgg
gaaggctggcacaatgcatcgggtgtgccactcaagggactgtatccaaaatttgtgaag
cttagcaaccaagcctatgtagctgatggtttcaatgacaccggagcatattggcgttcg
tggtatgagtccagttcctttgagaatgacctggaggttatttacaaacaggtgcagcca
ctctaccagaatcttcatgcctttgtacgtcgtaagctctacaaccactacggcccaaag
tacataaatctgaaaggacctatccctgctcaccttctaggaaacatgtgggcgcaaacc
tggaacaacatctatgacatgatgatccccttccccggaaaacctaatgtggatgtgacc
aaagaaatggaggccaataaatggaacgccactcacatgttccgtgtggctgaggagttc
ttcacatccctgggtctcatcaaaatgcctgatgagttctggaataagtctatgttggaa
aaaccagacgaccgggaggtggtgtgccatgcatctgcctgggacttctacaacagaaag
gacttcaggatcaaacagtgtaccaccgtcaacatgcaacagcttttcacggtgcaccac
gagatgggccacatcgaatactatctgcagtataaggaccaacctattagcttccgccgt
ggcgctaacccaggcttccatgaggccattggtgatgtcatgtccctgtctgtgtccacg
cctaaacatctggccagcatcggccttttgcccaatgcgaccaatgatcctgagagcgac
atcaactacctactgaagatggctctggagaagattgccttccttccctttggctatctt
atagaccaatggcgatggaacgtgtttagcggtcacactccaccagagcgctacaatgca
gactggtggcacctcaggacaaaataccagggtatctgtcctcccactaaacgtacagag
gaacacatggacgccggagcaaaataccacattccaggaaatactccttacatcagatac
tttgtgagtttcattctgcagttccagttccacaagaagctgtgtgatgcggcaggacac
cgtgggcccctgcacacatgtgacatttatcagtccaaagaggcaggaaagattttagag
acggtccttaaatcaggagaatccaaaccttggcaaaatgtgctccaggaagccattggt
acagacaagatgagcgccagtgcactgatggaatactttaaaccaatcatcacatggctg
gaggaacagaataaagccacaaatgaaaccctgggctggcctgactttaactgggttccc
sctgtaccagaaggctaccccgaggatgttgacaaggttacagatgagctgaaggctaag
gcattcctggaagagtacaatagaactgcggaggtggtctggaatgcatacactgaggct
tcgtgggcctataacaccaatatcaatgaagagaacaagcagacgatgctgaaaaaaaac
ttggaaatgtctaaccacacactgacctatggaaagaatgcacgcaagtacgataccaca
gacttccaggataattccgtgaagcgtatcctcaagaaactcagtgacattgaaagggct
ggacttccagacaatgaacttgtagagtacaacaatctgctggctaatatggagaccaag
tacagtgtggctaatgtgtgcagagacaatgggacctgccatccactggacccagacctc
cagaagatcatggctgagtcaagagactacagtgagcttctatttgcctggcagggctgg
agaaatgcctctggcagagaacttcgccaggactacaagagatatgtgcaactggccaat
aaagctgccacacttaatggacactctgacaatggagcattttggcgctccctgtatgag
acccccacctttgaagaggatcttgagtctctctggaaggagcttgaacccctctatctc
aatgtacacgcatatgtgcgcaggtccctctataagaaatacggcggaaaatacattaac
ctgaagggaccaatccctgcccatcttttaggtaacatgtgggcacagacctggtctggc
atcatggacttggccattccctaccccaatgccacacaggttgatgccacgccggccatg
atagccaagggctggaatgccgtaaggatgttcaatgagtcagaccacttcttcacttct
ctggggttgctgcctatgcctccagagttctggagtaaatccatgctggagaaacccacg
gatggccgcaatgtggtgtgtcatgcctccgcctgggacttttacaaccgcaaagacttc
aggatcaaacagtgcactgtggtaactatggatgatcttatcactgtgcaccatgagatg
ggtcacgtgcagtatttcctgcagtacaaagatcagcccatctccttccgtgacggtgcc
aaccccggcttccatgaggccatcggtgatgtgctggccctgtccgttgccactcccaga
catttaaaggagattggtttactagatgtggtggaagccaacaaggagagtacaatcaat
tacctcatgagtattgctctggacaaaatcgccttcctgcccttcggttacctgatggac
cagtggaggtggaaagtgtttgatgggcgcatctctgagtccgagtacaacaaggaatgg
tggaacatgagaatgaagtaccagggcttatgtccacctgtggcccgcactgagcaggac
tttgacccgggtgcaaagttccacattcctgccaacgtgccctatgtcaggtacttcgtg
agtttcatcattcagtttcagttccaccaggctctttgtaaggctgccaaccataaaggg
cctcttcatgaatgcgatatctaccgctctaaagaggcagggaaacttctaggtgatgta
atgaagctcggtttcagtaagccctggcctgaagcaatggccatgatcactggagagccc
gtcatgtccgccaagccactggttgagtacttcaaacccctcactgattggctggaggca
gagaacaacaagaatggcgaggtcagaggttggcctgagtacgactggaaaccgccaagt
cctggctccgtaacacttccactcaccacagtcccacatgataccagtccaacaattcca
ccacatgctgtggacttcctggggatgaaactggaccattcagcggcgtctgcgggccag
tgggtccttctggtcctgggcctggtgctcttagtggccaccattctcctgggctacaag
tacaagaaatccaaacggagaagtctgtcctcatctgaggtggagcttaagtaa

DBGET integrated database retrieval system